KEGG   Corynebacterium diphtheriae 31A: CD31A_0990Help
Entry
CD31A_0990        CDS       T01697                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cdz00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
982772..983629
Genome map
AA seq 285 aa AA seqDB search
MTRSAFQHDPECATVMAIVNRTPDSFYDHGATHALADAITRASAVIAQGAGIVDIGGVKA
GPGPYVSPSEEIERVVPVIDAVHRAHPEITISVDTWRAEVADVAIRAGASLVNDTWAGHD
PELAEVAGHYRVGYVCSHTGGVAPRTRPHRVRFDDIVASVIEETTAQAERAVRLGVPEDR
ILIDPTHDFGKNTFHGLELLRRIDEIVATGWPVLMALSNKDFVGETLARSVDQRVAGTLA
ATAWAAAHGVAAFRSHQVAETVDVIRMTAAIQGRVPPLATTRGLV
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgactaggagtgcgtttcaacacgatcccgagtgcgcaacggtcatggcgatcgttaat
cgcaccccagattccttttacgaccacggtgcgacccatgcgttagcagatgccataaca
cgcgccagtgctgtgattgcgcagggggcggggatcgtcgatattggtggggtcaaggca
ggtcctggcccttatgtctctcctagtgaggagattgaacgggtggtaccagttatcgac
gcagttcaccgtgcgcaccccgagatcaccatttcggtagatacgtggcgtgccgaggtc
gctgatgtggcgatccgcgccggggcgtcgttagtaaacgacacgtgggccggccatgat
ccggagcttgccgaggtagcgggacattatcgcgtgggatacgtgtgttctcatacggga
ggcgtagcgccacgcacccgcccgcaccgcgtgcgtttcgacgacatcgttgcctctgtt
attgaggaaacaacagctcaagctgagcgggcggttcgccttggtgttcctgaggaccgc
attcttatcgaccccacccatgattttggcaaaaacacctttcatggactggagctgctg
cggcgtatcgatgagattgtggcaaccggctggccagtactgatggccttgtctaacaaa
gattttgtaggagagacgctggctcgctctgtcgaccagcgtgtagccggaacccttgca
gctacagcgtgggcagcggctcatggagttgcggcttttcgttcgcaccaagtcgcagaa
accgtcgatgtgatccgcatgaccgccgcaatccaaggacgcgtgccacctctggctacc
acacgggggcttgtatga

DBGET integrated database retrieval system