KEGG   Corynebacterium diphtheriae 31A: CD31A_1410Help
Entry
CD31A_1410        CDS       T01697                                 

Gene name
msrB
Definition
peptide methionine sulfoxide reductase
Orthology
K07305  
peptide-methionine (R)-S-oxide reductase [EC:1.8.4.12]
Organism
cdz  Corynebacterium diphtheriae 31A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1451568..1451978
Genome map
AA seq 136 aa AA seqDB search
MTNFKLITDTEWRQRLSSEEYRVLREAGTEAPHTGEYTNTTTEGIYSCRACGTELFRSTE
KFNSHCGWPSFFSPLAGDKVIERTDTSHGMVRTEVICANCESHLGHVFAGEGYDTPTDLR
YCINSVCLTLIPAEES
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgacaaattttaaattgatcaccgacaccgaatggcgccagcgactcagcagcgaagag
taccgtgttttgcgcgaagcaggtaccgaagcacctcacactggggaatacaccaacacc
actacagagggcatctattcgtgccgtgcttgtggcaccgagctttttcgatcaacagaa
aagttcaattcccattgcggatggccttctttcttctcgccattagctggcgataaggtc
atagaacgcacagacacttctcatggtatggttcgcactgaagtaatctgcgcaaactgc
gaatctcatttaggacatgtctttgcaggtgaaggttacgatacccccacagatctgcgc
tattgcattaactctgtgtgcttaactttgattcctgcagaagaaagctaa

DBGET integrated database retrieval system