KEGG   Corynebacterium diphtheriae 31A: CD31A_1508Help
Entry
CD31A_1508        CDS       T01697                                 

Gene name
chlI2
Definition
(GenBank) magnesium chelatase subunit D
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
cdz00860  Porphyrin and chlorophyll metabolism
cdz01100  Metabolic pathways
cdz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CD31A_1508 (chlI2)
Enzymes [BR:cdz01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     CD31A_1508 (chlI2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM Sigma54_activat AAA_3 AAA AAA_16 AAA_30 AAA_32
Motif
Other DBs
NCBI-ProteinID: AEX42179
Position
complement(1552045..1553130)
Genome map
AA seq 361 aa AA seqDB search
MSTKQSPLFPFSAVVGQDQLRLALILTAISPRIGGVVIRGEKGTAKTTTVRAFAALLGDA
PLVNLPIGATEDRVVGSLDMETVLTTGKAKFRPGLLSQAHGGVLYVDEVNLLADHLVDAL
LDAAATGQVTVERDGISHTAPARFVLVGTMNPEEGELRPQLLDRFGLSVDVAASKDVQIR
AEIMRRRLDFESDPIDFAQRWHALDENTSQAIKSAQERVDSIVLTDTNLARIAHICASFD
VDGMRADLVIARTAIAHAAWRGDSLVTDEDIKVAAELALPHRRRRDPFDEPGLDQDQLDE
VMDEARDQHPEMDDPAEQSAHEDQIENETSNQEDHLDDQETQIPDSDGQEGSASQGAPFR
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgaagcagtctccgctttttcctttttctgccgttgtaggccaagatcaactg
cgactcgcgttaattcttacggcaatttcaccacgaattggtggcgtagtaatccgcggt
gaaaagggaaccgcaaaaacgacgacggttcgtgcatttgcagcgttgctaggtgatgcg
ccactggtcaatcttcccatcggagcaacggaagatcgcgttgttggctcgttagatatg
gagactgtgctaacaacaggaaaagctaagtttcgcccgggcttgctgtcccaagcgcat
ggtggtgttttgtacgtcgatgaggtcaacttgttggctgatcatctcgttgatgcgctt
cttgatgcggccgcgactgggcaggtgactgttgaacgtgatggtatttcgcatacagct
cctgctcgttttgtgctcgtaggaaccatgaatccagaagaaggggaattgcggcctcag
ctgctcgatcgttttggactttctgtagatgtagcagcatcgaaggatgttcagattcga
gcagaaattatgcgcagaagactcgattttgaatctgatcccattgactttgcacaacgc
tggcatgcactagacgagaacacgtcgcaagcaatcaagagtgcgcaagaacgtgtcgat
agcattgtgctcactgatacaaatttggcacgtatcgctcatatttgtgcttcttttgac
gttgatggcatgcgtgctgatctcgttattgctcgtactgctattgcccatgctgcatgg
cgcggagattcgctggtgactgacgaggacatcaaagtagcagcagaacttgctctgcca
catcgacgtcgtagggacccatttgatgaacccggccttgatcaagaccaacttgatgaa
gttatggatgaagcacgtgaccagcacccagagatggatgatcctgctgaacaatcagca
catgaggatcaaatagaaaacgaaacttctaatcaagaagatcatctagacgatcaagaa
actcagattcctgattccgatggtcaggagggcagcgcttctcaaggcgccccctttcgt
ccctaa

DBGET integrated database retrieval system