KEGG   Corynebacterium diphtheriae 31A: CD31A_1550Help
Entry
CD31A_1550        CDS       T01697                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:cdz03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1601504..1602394)
Genome map
AA seq 296 aa AA seqDB search
MPELPEVEVVRRGLTPYVLGATITDVAVEHPRSIRTVEGGAAELIGSLQGREVTRIGRRG
KFLWFELTGHGDSACGSPQQGLLVHLGMSGQMLIKTQNSALHPHRRIRTTIVRSDAQECF
ELWFVDQRTFGYWVPTTFVETAHGCVPEQITHIARDLLDPQLERENLARLIRKKNSEIKR
VLLNQEIVSGIGNIYADEMLWAARIHPQTPASHLSVAQLSNLLEHGQRVMNAALDQGGTS
FDSLYVNVNGQSGYFDVSLHAYGQQGQACDRCGSNIIREKFANRSSHFCPRCQLIH
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcttcctgaagttgaggttgtgcgtcgcgggcttacaccttatgtgcttggc
gcaactatcactgatgttgccgttgagcacccccgcagcattaggacagtcgaaggtggg
gccgccgaactcatagggtcgctacaaggtcgtgaggtcacgcgcataggtcgccgtggc
aaatttttgtggtttgagctcacaggccatggtgattctgcatgcggatctcctcagcaa
gggctactggttcatttgggaatgagcggtcaaatgctgataaaaactcaaaactcggct
ctgcatcctcatcgtagaattcgtaccacgattgttcgctcagatgctcaggaatgcttc
gagctttggtttgtcgatcagcgcacttttggctattgggtacccaccacatttgtagaa
actgctcacggatgcgttccagaacagatcactcacatagcgcgtgatcttttggatcct
caactagaaagagaaaatctagcgcgattgatccgcaagaaaaatagtgagattaaaaga
gttctgcttaaccaagaaatcgtctctggaataggcaatatttacgccgatgagatgttg
tgggctgcacgaatccatccacaaactcctgcgtcgcatttgtctgtcgcacaattaagt
aatttgctcgaacatggtcagcgagtcatgaacgcggctttagaccaaggcggaactagc
ttcgattctctttatgttaacgtcaatggccaatcggggtattttgatgtatcgcttcat
gcatacggccagcaaggccaagcgtgcgatcgctgtggttcgaatattatccgcgaaaag
tttgctaaccgctcgagtcatttttgcccacgttgtcagcttatacactag

DBGET integrated database retrieval system