KEGG   Corynebacterium diphtheriae 31A: CD31A_1618Help
Entry
CD31A_1618        CDS       T01697                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cdz00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CD31A_1618 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CD31A_1618 (murE)
Enzymes [BR:cdz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     CD31A_1618 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1672990..1674531)
Genome map
AA seq 513 aa AA seqDB search
MPTQSPHSCTLERLTELAGGRLVGETTAGATEISAIGLDSSQLPADAIFAALPGTKTHGA
HYASQGKAAAALAVLSDHEGTQILVDSGEKRPIIEVDDVRRVLGILSAEIYGHPSHEMTI
IGVTGTSGKTTTSYILERGLMAAGLHVGLIGTTGTRINGRKVPTKLTTPEAPTLQQLFSQ
MKAEGVSHVVMEVSSHALALGRVTGTRFSAAGFTNLSQDHLDFHPTMQEYFEAKALFFDP
ASPIHAEKSVVCVNDLWGKNMAERAGADAITVCAEQEAAVHQADYWVSNIDVNPVGAQSF
IVHHGAQSTDVHLPLPGGFNIANTVVALALAESVGVDKDAFIRGIADVAVPGRMERIDRG
QEFLAVVDYAHKPAAVAAVIDTVRDQVPGRIAVVVGAGGDRDSGKRPIMGAEAARRADLV
IVTDDNPRSEDPAKIREAVLEGAHGVAGSADIREIGDRREAIRTAVQWAQPGDAVIVAGK
GHEVGQLINGVDHHFDDREEVAAALHDQGFDLD
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
ttgcctactcaatctccgcattcatgtactctcgaacgtcttactgaacttgctggtgga
cgtctagtgggagaaactacagcgggtgcaacagagatttcggcgattggactggattca
tcgcagctaccagccgacgcaatctttgctgcacttccaggcaccaaaactcatggagct
cactacgctagccaagggaaagcagcggcagcactagctgtattaagcgatcacgaggga
acccaaatacttgtggattccggtgagaaacgtcccattatcgaggtagatgatgttcgc
agagtcctaggaatactcagtgcggagatttatgggcacccttctcacgaaatgaccatc
attggtgtgaccggaaccagcggtaaaaccacgacgagttatatccttgagcgcggtttg
atggcagccggcttacacgtcgggttgatcggcactactggaactcgtatcaatggacga
aaagtccctactaaattgacaacccctgaagctcccacgctgcagcagctatttagtcaa
atgaaggcagaaggcgtaagccacgtggtgatggaagtatctagccatgcgctggcgttg
gggcgtgtaacagggacgcggtttagtgcagctggctttaccaacctgtcacaggatcac
cttgattttcatcctacgatgcaagagtatttcgaggctaaagcgctgttctttgaccca
gcttcgccgatacacgctgaaaagtctgttgtgtgcgtaaacgatctctggggcaaaaac
atggctgagcgtgctggagcagacgccatcactgtgtgcgctgaacaagaggcagctgtc
caccaagctgattactgggtaagcaatatcgacgttaaccctgtcggcgcgcagtcattt
atcgtgcatcatggcgcacagtcaacggatgtgcatttgccactgcctggcggctttaat
attgcgaatacagtcgttgcgctggctttggcagaatccgtgggtgttgataaagacgcc
tttattcgtggcattgccgacgttgcagttccaggacgtatggagcgcatcgatcgaggt
caagagttccttgctgtcgtggactatgcccataaaccagcagccgtagctgcagttata
gatacggtccgtgaccaagttccaggacggattgcggtcgtcgtaggagcaggcggcgat
cgtgattccggcaaacggccaattatgggcgccgaagcagcgcgtcgagcagatttggtc
attgtgactgacgataaccctaggtcggaggatcctgcgaaaattcgtgaggcagtatta
gaaggcgcccatggtgttgcaggatcagcagatattcgtgaaatcggagatcgtagggaa
gcaattcgtactgcagtgcaatgggctcagcccggcgacgccgtcatcgttgctggaaaa
ggccatgaagttggtcagctcattaacggagtcgatcatcacttcgatgatcgtgaggaa
gtagcagctgctctgcatgatcaagggttcgacctagattaa

DBGET integrated database retrieval system