KEGG   Corynebacterium diphtheriae 31A: CD31A_1653Help
Entry
CD31A_1653        CDS       T01697                                 

Gene name
sucB
Definition
dihydrolipoamide acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cdz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CD31A_1653 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CD31A_1653 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CD31A_1653 (sucB)
Enzymes [BR:cdz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CD31A_1653 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1711704..1713317
Genome map
AA seq 537 aa AA seqDB search
MAHSVVMPELGESVTEGTITQWLKSVGDTVTADEPLLEVSTDKVDTEVPSPVSGVLLEIK
FEEDDTVDVGDVIAIIGEEGDAPAAKEEPAEEPKAEAPKAEAADSTDVVMPELGESVTEG
TITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGTILEILFNEDDTVDVGDVIVRVG
TPGSAPAAKEEPAEEPQQEAPKEEPKAEAPKAEAKKEAPAKNINNENVPYVTPLVRKLAD
KHGVDLTTVEGTGIGGRIRKQDVLAAAGVGAAPAAQAAPAQPVSAASTKSVDPEKQKLIG
TTQKVNRIREITARKTVEALQISAQLTQLHEVDMTKVAELRKANKPAFQEKHGVNLTYLP
FFAKAIVEALVAHPNVNASYNAETKEMTYHADVNLSIAVDTPAGLLTPVIHKAQELSLPE
LAKAIVDLADRARNNKLKPNDLSGGTFTITNIGSEGALSDTPILVPPQAGILGTGAIVKR
PVVITEDGIDSIAIRQMVYLPLTYDHQIVDGADAGRFLTTIKDRLETANFEGDLELS
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgtaatgcctgaactgggcgaatccgtcaccgaaggtaccatcacc
cagtggctgaagtccgttggtgacacggtcactgccgacgagccgttgctcgaggtatct
actgacaaggtcgacactgaagttccttcgcctgtctccggtgtcttgcttgagatcaag
tttgaggaagatgacaccgtagacgtcggagacgttattgcgattattggcgaagaaggc
gacgctccagcagccaaggaagagccagccgaggagccaaaagccgaggcaccaaaggct
gaagcagctgactccaccgacgtagtcatgccagaactcggcgaatccgtcaccgaaggc
accatcacccagtggctgaagtccgttggcgacaccgtcgacgttgacgaaccactcctc
gaagtctccaccgacaaggtagacaccgaagtcccatccccagtcgctggcaccatcctc
gaaattctcttcaacgaagacgacaccgtcgacgtcggagacgtaatcgttcgcgttggc
accccaggatctgctccagctgccaaggaagagccagccgaggagccacagcaagaagca
ccaaaggaagagccaaaagctgaggcaccaaaggctgaagcaaagaaggaagctcctgcc
aagaacatcaacaacgagaacgtcccttacgtcactccactggtccgcaagctggctgac
aagcacggcgttgatctgaccactgtggaaggcactggtatcggtggacgcatccgcaag
caggatgttttggctgccgctggtgttggcgcagctcctgcagcacaggctgctcctgcc
cagccagtttctgcagcatccaccaagtccgtggatccagagaagcagaagctgatcggt
accactcaaaaggtcaaccgtatccgcgaaatcaccgctcgcaagactgtggaggctttg
cagatttctgctcagctcacccagctgcatgaggtcgatatgaccaaggttgcggaactt
cgtaaggccaacaagccagccttccaggaaaagcacggtgtgaacctcacctacttgcca
ttctttgcaaaagcaattgttgaggctttggttgcccatccgaacgtcaatgcgtcctac
aacgctgagaccaaggaaatgacctaccacgctgatgtcaacctctccattgctgttgat
accccagctggtctgctcacccctgtaatccacaaagctcaagagttgtctttgccggag
ctagctaaggcaattgtcgacttggctgaccgtgctcgtaacaacaagctcaagccgaat
gacctttccggcggtaccttcaccattaccaacattggttccgaaggtgcactcagcgat
accccaatcttggttcctccacaggcaggcatcttgggcaccggcgctattgttaagcgt
ccagtagtcatcacggaagacggcatcgattcgattgctattcgccagatggtctacttg
ccacttacctacgatcaccagatcgtcgatggtgccgatgcaggtcgtttcttgaccacc
atcaaggatcgcctcgagactgccaacttcgaaggtgacctcgaactctcgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system