KEGG   Corynebacterium diphtheriae 31A: CD31A_1732Help
Entry
CD31A_1732        CDS       T01697                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cdz00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1790494..1792662
Genome map
AA seq 722 aa AA seqDB search
MSYSDLLRELAAAHAISSSYSGFGGAHVEVSDDTLVKTLRSLGVCFGNEDEPATDHEPLT
GPMPSEDQIRYALQQRYDAEATRPLPRCVVAVEGDPYVFNVHVHDGAPADITITLEDGST
AEVTQVENWAPPREVDGITWGEASFQLPSDLPLGWHTITLTSDTLTSSCFLIVTPARLST
ADKYAEHPVSGVMAQLYSARSKNSWGMGDFNDLGLLAETLAPQADYLLINPLHAAEPMPP
VEDSPYLPTTRRFINPIYIRIEDIPEHLLLDDDLQNDVAELAEEFTALNLTPEKIERNPI
FDAKLQVLHAVFNVEREPAREQDFQDFIATEGQGLRDFASWCADQELAVLESSAAHAALP
EKESLIQFYMWQQWICDQQLGAAQTRATDAGMSIGIIADLAVGIHPAGADALSLADTLVA
RASVGAPPDSYNHQGQDWSQPPWHPDRLAESGYIPWRDLLRTVLRHAGGVRVDHILGLFR
LFWIPRTQSPQTGTYVNYDHNALVGVLALEAERAGAVVIGEDLGTFEPWVQDFLASRGIM
GTSVLWFESSPEGGPRKQHEYRQLALTSVTTHDLPPTAGYLAGEHIALREELGILTTDVA
TEYAEDLNWQADILNVVRNSGAFESIVPADFHGVDRADRGSSVELLSALHRFLAGTPSAL
TCTALVDLVADKRAQNQPGTTSDQYPNWCIPLCDESGTPVLIEDLAENPVYQAVTKASTR
LH
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
gtgagttactcagatttgttacgcgagctggccgctgcccacgcaatctcttcgtcgtac
tccggtttcggtggagcacacgtggaagtttcggatgacacgctggtcaagaccctgcga
tccctcggagtttgcttcggaaatgaagacgaacccgccaccgaccacgagcctttgact
gggcctatgcctagcgaggaccaaatccgctacgccctacaacagcgttacgacgccgaa
gcaacccgccccctcccccgatgtgtggttgccgtcgaaggtgatccctacgtgttcaac
gtccatgttcacgacggtgctcccgccgacatcaccatcactttggaagatggttcaacc
gcagaggttacccaggttgaaaactgggccccaccccgtgaagttgatggcattacttgg
ggtgaagcttccttccagctgccgtccgaccttccactgggctggcacaccatcaccttg
acctccgacacgctaacgtcaagctgtttcctcatcgtgaccccagcgcgtctatctacc
gccgacaagtatgcagagcaccctgtcagcggtgttatggcgcagctgtactctgctcgt
agtaagaattcttggggcatgggcgatttcaacgatctcggcctgctggctgagacgctt
gctcctcaggctgactatctgttgattaaccctctgcacgccgctgagccgatgccacca
gttgaggattccccatacttgcctactacgcggcgttttatcaacccaatttatatccgc
atcgaagatatccctgagcacttgcttctcgacgatgacctacagaatgatgtcgccgag
ctcgcggaagagtttacagcacttaatctcacccctgaaaagattgagcgcaatccaatt
tttgatgccaagttgcaggttctgcacgcggtattcaatgtagagcgcgaacctgcacgt
gaacaggacttccaggacttcatcgccaccgaaggccaaggcctacgcgacttcgcttca
tggtgtgccgaccaagaactagcagttttggagagctccgcagcacatgccgctcttccg
gaaaaagagtctcttatccagttctacatgtggcagcagtggatttgcgatcaacagctt
ggtgctgctcaaacccgcgcaaccgacgctggaatgagcatcggtatcatcgccgatctc
gcagtgggcattcatcctgcgggtgccgatgcactttcgcttgccgacaccctagtcgcc
cgcgcttctgtgggggcgccaccagatagctacaaccaccaaggccaagactggtctcag
ccaccatggcacccagaccgcttggcagagtctggctatatcccatggcgtgacctgctg
cgcacggtgcttcgccacgccggtggtgtccgtgtagaccacattcttggtcttttccgc
ttgttctggattccacgtacgcagtctccacaaacgggtacttacgtcaactacgatcac
aacgcacttgtgggcgtacttgctcttgaggcagagcgtgcaggcgcagtggttatcggt
gaagacctcggtaccttcgagccatgggttcaagacttccttgcgtcccgaggcatcatg
ggtacttcagtgctgtggttcgaaagttccccagaaggtggcccacgcaagcagcacgag
taccgtcagttggcgctgacctcggtaaccacccatgatctgccaccaacagcgggctat
ctggcaggcgagcacattgcgttgcgtgaggaactcggaattttgaccaccgatgtagca
actgagtatgccgaggatttgaactggcaggcagacatcctcaatgtagttcgcaactcg
ggcgcatttgagtccatcgttcctgccgatttccacggtgtagatcgtgctgaccgcggc
agctccgtcgagctgctttcggcgttgcaccgcttcttggctggtacaccatcagctctg
acctgcaccgcattggtggatcttgtcgccgataagcgcgctcaaaaccagccgggcact
acttcggatcagtacccgaactggtgtattccgctatgcgacgagtccggcactccagtc
cttatcgaggacttggccgaaaaccccgtctatcaagcggtaacaaaggcgtcgactcgc
ctacattag

DBGET integrated database retrieval system