KEGG   Corynebacterium diphtheriae 31A: CD31A_1776Help
Entry
CD31A_1776        CDS       T01697                                 

Gene name
gpmB
Definition
phosphoglycerate mutase
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cdz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CD31A_1776 (gpmB)
   01230 Biosynthesis of amino acids
    CD31A_1776 (gpmB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD31A_1776 (gpmB)
  Energy metabolism
   00680 Methane metabolism
    CD31A_1776 (gpmB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CD31A_1776 (gpmB)
Enzymes [BR:cdz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     CD31A_1776 (gpmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1838627..1839349)
Genome map
AA seq 240 aa AA seqDB search
MSRCLIVLRHGQTEYNATKRMQGHLDTVLSDAGWAQAEAAADFLTTLPIGKIVSSDLARA
HDTATVVGQRLGVDVSTDQRLRETNLGDWQAKTHEEVDEHYPGARALWRHDATWAPPNGE
SRIHVAQRARAVVDELMRDYDEWDDCSVLLVAHGGTISALTSSLLGLHQEQYSLISGLGN
TCWAQLTARPRFHGAASENAEKEAADYVDQLSARFTPQTVTDAQWYLEGWNMGVALGSNL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgttgcctcattgtgctgcgccacggccaaaccgaatacaacgccacgaagcgt
atgcaaggacacttggatactgtgctgtcggatgctggttgggcgcaagcagaagcggcg
gcggattttcttaccacgttgccgatcggcaagatcgtctcttccgatctcgcccgcgcc
catgacaccgctactgttgtagggcaacgccttggcgtagacgtctctactgaccagcgc
ttacgcgaaaccaatctgggggattggcaggcgaagacgcatgaagaggtagacgaacac
tatcccggtgcgcgtgcgttgtggcgtcacgacgccacctgggcgccacctaacggcgaa
tcccgtatccatgttgcgcagcgtgcccgcgcagttgtcgacgagctcatgcgcgactat
gacgaatgggatgattgcagcgtgctgcttgttgcccacggcggcaccattagtgcactg
acctctagtttgttgggattgcaccaagagcagtattcgctgatctctgggctggggaac
acctgctgggcgcagctgaccgcgcggccacgcttccacggtgcggcttcagaaaacgcc
gaaaaagaggctgcggattacgtcgatcagctctctgcgcgttttaccccgcagacggtg
actgatgcgcagtggtacctcgaaggctggaatatgggcgtggcgttaggaagcaacctt
tag

DBGET integrated database retrieval system