KEGG   Corynebacterium diphtheriae 31A: CD31A_1964Help
Entry
CD31A_1964        CDS       T01697                                 

Gene name
deoA
Definition
Thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdz00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CD31A_1964 (deoA)
Enzymes [BR:cdz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     CD31A_1964 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2040629..2041912)
Genome map
AA seq 427 aa AA seqDB search
MAEQFDAVDIIRTKRDGGELTTEQINWVIDAYTRGAIGDEQMAALNMAIFIRDMNRREIV
DWTKAMINSGETMDFSALGKKTTDKHSTGGVGDKLSLPLGPLVASYGLAVPMLSGRGLGH
TGGTLDKLEAIPGFEVDIDNDRMMNILKDAGVVIASAGSGLAPADKKIYALRDITSTVDC
VPLIASSIMSKKIAAGADSLILDVKVGSGAFMKDLDHARELARTMVDLGNDAGVHTRALL
TDMSTPLGKKIGNSLEIEETVEVLAGGGPEDVVKLTCELARNMLEMAGIHDADVEERLKD
GRAMDVWKRMVRAQGGDPEAPMARAEHTHEVVADRDGYLMELDALALGVGSWRLGAGRAR
KEDPVQLTAGIEIHADLGQKVVKGQKLLTLHTETPDKFDRALESIIPGIAIGDEQPAERQ
IILDRIV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacaattcgacgccgtggacatcattcggaccaagcgcgatggtggcgaactc
accaccgaacaaatcaactgggtgatcgacgcctacacccgcggagccatcggcgacgag
caaatggcagcactcaacatggccatcttcatccgcgacatgaaccgccgcgagatcgtc
gactggaccaaagccatgatcaactccggcgaaaccatggacttcagcgcccttggcaaa
aagaccaccgacaagcactccaccggtggcgtgggcgacaaactctccctgccactcggc
ccactcgtggcaagctacgggctcgcagtgcctatgctctccggccgcggactcggccac
accggcggcaccctagacaagctcgaagcaatcccaggcttcgaggtagacatcgacaac
gaccgcatgatgaacatcctcaaagatgccggcgttgttatcgcctccgcaggatccgga
cttgcacccgcagataagaagatctacgcgctgcgcgacatcacctccaccgtcgactgc
gtcccactgatcgcaagctccatcatgagcaagaagatcgccgccggtgccgactccctc
atcttggacgtcaaggtcggaagcggtgcctttatgaaagacctcgaccacgcccgcgaa
ctcgcccgcaccatggtcgacctaggtaacgacgcaggcgttcacacccgtgcgctgctc
accgacatgtccacaccactgggcaagaagatcggtaactccctcgaaatcgaggaaacc
gtcgaggttctcgccggcggcggcccagaagacgtggtcaagctcacctgcgaacttgcc
cgcaacatgctcgaaatggccggaatccacgacgcagacgttgaagaacgcctcaaagac
ggacgcgccatggacgtgtggaagcgcatggtccgcgcacaaggcggcgacccagaagcc
ccaatggcacgcgcagagcacacccatgaagttgtcgccgaccgcgacggctacctcatg
gaactcgacgccctcgcgctcggtgttggcagctggcgcctcggtgccggacgcgcacgc
aaagaagacccggtgcagctcaccgccggtatcgaaatccacgccgatctgggccaaaaa
gttgtcaagggacaaaaactgctcaccctgcacactgaaaccccagacaagttcgaccgt
gccctcgaatccatcattcctggcatcgcgatcggtgacgaacaaccagctgaacgtcag
atcatcctcgaccgaatcgtctaa

DBGET integrated database retrieval system