KEGG   Corynebacterium diphtheriae 31A: CD31A_1992Help
Entry
CD31A_1992        CDS       T01697                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cdz00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2068515..2069087)
Genome map
AA seq 190 aa AA seqDB search
MTAQFDQQRAEAAVRELLIAVGEDPDREGLQETPARVAKAYAEMFAGLHTDPTEVLAKTF
SEDHREVVLVRDIPIYSTCEHHLVPFFGKAHIGYIPGESGKVTGLSKLARLVDLYAKRPQ
VQERLTTQVADALVDKLQAQAVIVVIECEHLCMAMRGIRKPGAVTTTSAVRGGFKTNAAS
RAEVLSLIRS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacaatttgatcaacaacgcgccgaagccgcagtccgagaactcctcatcgcc
gtcggtgaagatcccgaccgcgaaggactgcaagaaaccccagcgcgcgtagccaaggcc
tacgctgaaatgttcgcaggcctgcacaccgaccccaccgaggtcctcgctaaaaccttc
agcgaggaccatcgggaagtggtcctagtccgcgacatcccgatctactccacctgcgaa
caccacctagtgcccttcttcggcaaagcacacatcggctacatcccaggtgaatccgga
aaagtcaccggcctatccaaactcgcacgactcgttgacctctacgccaaacgcccccag
gtccaagaacgcctgaccacccaagtggcagacgcactggtagacaagctacaagcccaa
gcagtcatcgtggtcatcgaatgcgaacatctctgcatggccatgcgcggtatccgcaaa
ccaggagccgtgaccaccacgtctgcagttcgcggcggatttaaaaccaacgcagcctcc
cgcgcagaagtactcagcctcatccgcagctaa

DBGET integrated database retrieval system