KEGG   Corynebacterium diphtheriae 31A: CD31A_2139Help
Entry
CD31A_2139        CDS       T01697                                 

Gene name
adhB
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cdz00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CD31A_2139 (adhB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD31A_2139 (adhB)
  Lipid metabolism
   00071 Fatty acid degradation
    CD31A_2139 (adhB)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CD31A_2139 (adhB)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CD31A_2139 (adhB)
   00626 Naphthalene degradation
    CD31A_2139 (adhB)
Enzymes [BR:cdz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CD31A_2139 (adhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2211142..2212182)
Genome map
AA seq 346 aa AA seqDB search
MSATEFPSAFTAAVVDKFGSELNIHDVDLPEPGQHQALVKVLTSGICHTDLHAAEGDWPV
KPKPPFVPGHEGVGEVVKLGPGEHSVALGDMVGNVWLWSACGECEYCRTGWETMCEKAEY
GGYTVDGSFGQYMLVDTRYCARIPDGCDLLEVAPILCAGVTVYKGLKVTETRPGQFVVIS
GVGGLGHIAVQYAVAMGMRVIAVDIADDKLELAKKHGAEFVVNAREEDPTEAIVKYTKGG
AHGVLVTAVHPQAFGQAIGMARKNGTIVFNGLPPGEFPAPIFDIVFKGLTIRGSLVGTRQ
DLEEALDFYARGMIKPTVTECKLDDVNSVFADMKQGKIDGRMAIRY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctactgaattcccctctgccttcaccgccgctgttgtggacaagtttggctcc
gagctcaacattcacgacgttgacctcccagagccaggtcaacaccaagcactggttaag
gtgctcacctctggcatctgccacactgacctccacgccgccgaaggcgactggccagtc
aagccaaagccaccattcgtcccaggccacgagggcgtaggcgaagtggtcaaacttggc
ccaggtgagcatagcgttgcgctgggtgacatggtcggtaacgtctggctctggtcagct
tgtggcgagtgtgaatactgccgcaccggctgggagaccatgtgcgagaaagccgagtac
ggtggatacaccgtcgatggctctttcggtcagtacatgctggtagatactcgctactgt
gcccgcatccctgatggctgtgacctgctggaagtcgccccaattctgtgcgctggcgtg
accgtgtacaagggcctgaaggttaccgaaacccgcccaggccagttcgtggtcatctct
ggcgtgggtggtctgggccatatcgccgtccagtacgccgtggctatgggcatgcgcgtt
atcgccgtggatattgcggacgacaagctcgaactggctaagaagcatggcgctgagttt
gtggtcaatgctcgtgaagaagacccaactgaggcaattgtgaagtacaccaagggtggc
gcacacggcgtgctggtcaccgcggtgcaccctcaggccttcggtcaggcaattggcatg
gctcgtaagaacggaaccattgtgttcaatggtcttcctccaggagagttcccagcaccg
attttcgacatcgtgttcaagggcctgaccatccgcggctccctcgtgggaacgcgccaa
gaccttgaagaggctttggacttctacgctcgcggcatgatcaagccaacggttactgaa
tgcaagcttgacgacgtcaactcggtctttgctgatatgaagcaaggcaagatcgacggc
cgcatggctatccgctactag

DBGET integrated database retrieval system