KEGG   Corynebacterium diphtheriae 31A: CD31A_2139Help
Entry
CD31A_2139        CDS       T01697                                 

Gene name
adhB
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
cdz00010  Glycolysis / Gluconeogenesis
cdz00071  Fatty acid degradation
cdz00350  Tyrosine metabolism
cdz00625  Chloroalkane and chloroalkene degradation
cdz00626  Naphthalene degradation
cdz01100  Metabolic pathways
cdz01110  Biosynthesis of secondary metabolites
cdz01120  Microbial metabolism in diverse environments
cdz01130  Biosynthesis of antibiotics
cdz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cdz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD31A_2139 (adhB)
  Lipid metabolism
   00071 Fatty acid degradation
    CD31A_2139 (adhB)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CD31A_2139 (adhB)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CD31A_2139 (adhB)
   00626 Naphthalene degradation
    CD31A_2139 (adhB)
Enzymes [BR:cdz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CD31A_2139 (adhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C adh_short TrkA_N ThiF
Motif
Other DBs
NCBI-ProteinID: AEX42806
Position
complement(2211142..2212182)
Genome map
AA seq 346 aa AA seqDB search
MSATEFPSAFTAAVVDKFGSELNIHDVDLPEPGQHQALVKVLTSGICHTDLHAAEGDWPV
KPKPPFVPGHEGVGEVVKLGPGEHSVALGDMVGNVWLWSACGECEYCRTGWETMCEKAEY
GGYTVDGSFGQYMLVDTRYCARIPDGCDLLEVAPILCAGVTVYKGLKVTETRPGQFVVIS
GVGGLGHIAVQYAVAMGMRVIAVDIADDKLELAKKHGAEFVVNAREEDPTEAIVKYTKGG
AHGVLVTAVHPQAFGQAIGMARKNGTIVFNGLPPGEFPAPIFDIVFKGLTIRGSLVGTRQ
DLEEALDFYARGMIKPTVTECKLDDVNSVFADMKQGKIDGRMAIRY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctactgaattcccctctgccttcaccgccgctgttgtggacaagtttggctcc
gagctcaacattcacgacgttgacctcccagagccaggtcaacaccaagcactggttaag
gtgctcacctctggcatctgccacactgacctccacgccgccgaaggcgactggccagtc
aagccaaagccaccattcgtcccaggccacgagggcgtaggcgaagtggtcaaacttggc
ccaggtgagcatagcgttgcgctgggtgacatggtcggtaacgtctggctctggtcagct
tgtggcgagtgtgaatactgccgcaccggctgggagaccatgtgcgagaaagccgagtac
ggtggatacaccgtcgatggctctttcggtcagtacatgctggtagatactcgctactgt
gcccgcatccctgatggctgtgacctgctggaagtcgccccaattctgtgcgctggcgtg
accgtgtacaagggcctgaaggttaccgaaacccgcccaggccagttcgtggtcatctct
ggcgtgggtggtctgggccatatcgccgtccagtacgccgtggctatgggcatgcgcgtt
atcgccgtggatattgcggacgacaagctcgaactggctaagaagcatggcgctgagttt
gtggtcaatgctcgtgaagaagacccaactgaggcaattgtgaagtacaccaagggtggc
gcacacggcgtgctggtcaccgcggtgcaccctcaggccttcggtcaggcaattggcatg
gctcgtaagaacggaaccattgtgttcaatggtcttcctccaggagagttcccagcaccg
attttcgacatcgtgttcaagggcctgaccatccgcggctccctcgtgggaacgcgccaa
gaccttgaagaggctttggacttctacgctcgcggcatgatcaagccaacggttactgaa
tgcaagcttgacgacgtcaactcggtctttgctgatatgaagcaaggcaagatcgacggc
cgcatggctatccgctactag

DBGET integrated database retrieval system