KEGG   Corynebacterium diphtheriae 31A: CD31A_2373Help
Entry
CD31A_2373        CDS       T01697                                 

Gene name
trpB1
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CD31A_2373 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CD31A_2373 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CD31A_2373 (trpB1)
Enzymes [BR:cdz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CD31A_2373 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2503214..2504545
Genome map
AA seq 443 aa AA seqDB search
MTDSTIRKTLISAYFGNYGGQFVPDALLPVLDELEQAYVDALNDPEFSRELARLQKHYLG
RPTPITECANLPLAGKGKGKARIFLKREDLVHGGAHKGNQVLAQALIARRLGKTRLIAET
GAGQHGTATAMVAALMGMDCTIYMGAKDVARQQPNVYRMRLMGATVVPVTNEHGDSMSDA
IDVALMDWVENLDTTHYLIGSAVGPHPFPTLVKEFQAVISRESREQMLELTGKLPDAVIA
AVGGGSNAIGAFADYLTDKPGNESVRLIGVEPAGEGLDSGKHGAPLQRGKVGVQHGFKSF
ILADEQGNPLHSYSVSAGLDYPGVGPEHAHLMESGRAQYYGITDAEALQAFRMLSHYEGI
IPALESSHALAYALKMAENAEETDTPINIVVNLSGRGDKDVDYVRNILGDLATEDPATSP
VTDPHVAETLATMIAESNAREGV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaccatccgcaagacgttaatcagcgcctactttggtaactacggcgga
cagtttgttcccgatgcgctcctgccggttctcgacgaactagagcaggcctatgtggat
gcactcaacgacccagagttttcgcgggaacttgctcggctacaaaagcactaccttggt
cgtcccactcctattaccgaatgcgccaatcttcccctagcaggtaaggggaagggtaag
gcgcggatcttcctcaaacgcgaggatctagttcacggtggcgcacataagggcaatcag
gtgcttgcccaggcgttgattgctcgcagattgggtaaaactcgtttgatcgcagaaacc
ggtgctggtcagcacggtaccgccactgcgatggtggcggctttgatgggaatggactgc
accatttatatgggtgctaaagatgtggcccgccagcagcccaatgtgtatcgcatgcgg
ctcatgggggctacggtggtgccagtaaccaacgagcatggtgattccatgtcggatgct
atcgacgtagcgcttatggactgggtggaaaacctagataccacgcactacctgattggt
tctgcggtcggtccacatccgttccctacgctggtcaaggagtttcaggcggttatttcg
cgggaatctcgcgaacagatgctggagctaacaggcaagcttccggacgcagtgattgct
gccgtaggcggtggttcgaatgctattggtgcgtttgctgattacctcacggataagcca
ggtaatgagtccgtgcgtttgattggtgtggagccagcaggtgagggtcttgattccggt
aagcatggtgcgccgctgcagcgtggcaaggttggtgtgcaacacggcttcaagtcgttc
atcttggctgatgagcagggcaatccgctgcattcttattccgtatcggctggtcttgat
tatccgggcgtgggtccagaacacgcccacctcatggaatctggtcgtgcacaatattat
ggaattaccgatgccgaggcgcttcaggcattccgaatgctaagccactacgagggtatc
attccagctttggagtctagccatgctctagcatatgcgttaaagatggcggaaaacgcc
gaggaaaccgatactcccattaatattgtggtcaatctttcaggtcgtggcgataaagat
gtggactatgttcgcaatatcttgggcgatctcgctaccgaggatccagcaacctcacca
gtcacggatcctcatgtcgccgaaaccctcgccacaatgatcgctgagtccaatgcacga
gagggagtctaa

DBGET integrated database retrieval system