KEGG   Corynebacterium diphtheriae 31A: CD31A_2377Help
Entry
CD31A_2377        CDS       T01697                                 

Gene name
trpC1
Definition
indole-3-glycerol phosphate synthase
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CD31A_2377 (trpC1)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CD31A_2377 (trpC1)
Enzymes [BR:cdz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CD31A_2377 (trpC1)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CD31A_2377 (trpC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2507775..2509232
Genome map
AA seq 485 aa AA seqDB search
MQNDSSTSPMPTVLESIVSGRRSHLPEIQARISHVDPARLPRSTRSLFHALGGHSDGGPA
LRGSARFIMECKSSSPSLGMIREDYRPGDIARVYSRYAAGISVLCEPDRFGGDYNHLATV
AATTHLPVLCKDFIIHPAQVHAARYFGADAILLMLSVLDDATYTELSQEAARLGLDVLTE
VIDEVEVERAIRLGATIFGINHRNLHDLSIDLNRSARLVPLIPDSAVIVSESGIRDNETV
RQLSGHSSAFLVGSQLTSQPDVDRAARELVYGHNKVCGLQSPSEAQAARASGAIYGGLIF
EESSPRNVSRETSKKIMAAEPELTYVAVSRHTTGWAEIIGDNIAVAQIHSPYQGSIAAEK
ELINHVRGEVGDKVKIWRAVSMTHADGSLVAEALAPEVDRLVLDTGNGGTGSTFDWARIP
EAIKGKTLLAGGIGPDNVTEALAVGCAGLDLNSGLEYPAEAGKWATHKDAAAIHSTFTQI
RGFHY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatgattcgtcgacaagccccatgcccaccgtcctagaatccatcgtttcgggc
cggcgttcccacctgcccgaaatccaggcgcggatttctcacgtggacccggcgcgacta
ccgcgttccacccgctccttgttccacgccttgggaggccatagcgatggcggtccggcg
ttgcgggggagtgcgcgctttatcatggagtgcaagtcctcctcgccgtcgcttggcatg
atccgcgaggattatcgccctggcgacatcgcgcgggtgtattcacgttatgcggccggc
atttcggtgttgtgcgagccggatcgttttggcggcgactataaccatctggccacggtg
gcggccacgacacatctgccggtgctgtgcaaggattttattatccaccccgcacaggtt
cacgcggcccgttattttggggcggacgcaattttgctcatgttgagtgtgcttgacgac
gccacctacaccgagctcagccaggaagcagcacgcttggggttggatgttctcaccgag
gttatcgacgaggttgaggtggaacgtgccattcggttgggggctacaatctttggcatt
aatcatcgcaatctgcatgatttgagcattgatttgaatcgctcagcacgtcttgtgcca
ctgattcccgatagcgcagtgattgtctccgagtctggcattcgggataacgagacggtt
cgccaactcagcgggcattccagtgcgttcctcgtaggctcgcagcttacttctcagcca
gatgtggaccgcgcggcccgtgagcttgtgtacggccacaataaggtgtgcggtttgcag
tcgccaagcgaggcgcaagcagcgcgcgcatcgggtgcaatctatggcggattgatcttc
gaggagtctagtccgcgtaatgtttcacgtgaaacatcgaaaaaaatcatggctgccgaa
cccgaacttacctatgtcgccgtctcacgacacaccaccggatgggccgaaatcataggt
gacaacatcgccgttgctcagattcacagtccttaccagggctccatcgccgccgaaaaa
gaactcattaaccatgtgcgcggcgaggtaggagacaaggtaaaaatctggcgtgcggtc
tccatgacgcatgccgacggctcccttgtcgccgaggcgctcgcacccgaggtagacaga
ctcgtcctcgacaccggcaatggcggaacgggtagcaccttcgattgggcacgcatccca
gaagccataaagggcaagactcttctcgccggcggcattggaccagacaatgtcaccgag
gcactcgccgttggctgcgcaggactcgatctcaactctgggttggaatatccagccgaa
gcggggaagtgggcaacacacaaagacgctgctgcaatccactccactttcacccaaata
cgtggttttcattactaa

DBGET integrated database retrieval system