KEGG   Corynebacterium diphtheriae 31A: CD31A_2382Help
Entry
CD31A_2382        CDS       T01697                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CD31A_2382 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CD31A_2382 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CD31A_2382 (trpA)
Enzymes [BR:cdz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CD31A_2382 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2512884..2513720
Genome map
AA seq 278 aa AA seqDB search
MTRYTKLFSALSAKNEGAFVPFIMLGDPTPEASLAIIRTAVAAGADALELGVPFSDPVAD
GPTIQRSHLRALDNGATVDSSLELIRQIRKEFPELPIGMLIYGNVVFTRGITQFYQEFAD
AGVDSILLPDVPVREGEPFIAAAKQPGIDPIFIAPAQASEATLEEVAQHSSGYIYAISRD
GVTGTERESSTRGLEQVVANVKRFGGAPILLGFGISTPEHVRDAIAAGASGAITGSALTS
IIERHTTGTHPEPAQVTDLEALTEEIFAFVKDMKAATR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgactcgctacaccaaattattctccgcactcagcgccaaaaacgaaggagcattcgtc
cccttcatcatgctgggcgatcccaccccagaggcgtcgttagcaatcatccgtaccgcc
gttgccgcgggtgccgacgccctcgaactcggcgtccccttctccgacccggtagcagac
ggccccacaatccaacgctcccacctccgtgccctcgacaacggagccaccgtcgatagc
tcgctggaactgatccgacagatccgcaaagaattccccgaacttcccatcggcatgctc
atctacggcaacgttgtcttcacccgcgggatcacccagttctatcaagaattcgccgac
gccggcgtagactccatcctgcttcccgacgtccctgtccgcgaaggcgagcctttcatc
gcagctgccaagcaacctgggatcgaccccatcttcatcgcccccgcacaagcctcggaa
gcaaccttggaagaggtagcgcaacactccagcggatacatctacgccatctcccgcgat
ggtgtgaccggaaccgaacgggaatcctctactaggggactagagcaagtggtagcaaat
gtgaaacgcttcggcggtgcaccgatcctgctcggtttcggcatctccacacccgagcat
gtgcgcgacgcaatcgcggcaggagccagcggcgccattacaggctccgcactgacgtcg
atcatcgagcggcacaccacaggcacgcacccagagccagcccaagtgacagaccttgag
gctctgaccgaagaaattttcgcgttcgttaaagacatgaaagccgcaacccgttaa

DBGET integrated database retrieval system