KEGG   Corynebacterium efficiens: CE0053Help
Entry
CE0053            CDS       T00103                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cef  Corynebacterium efficiens
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CE0053
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CE0053
  Lipid metabolism
   00071 Fatty acid degradation
    CE0053
  Amino acid metabolism
   00350 Tyrosine metabolism
    CE0053
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CE0053
   00626 Naphthalene degradation
    CE0053
Enzymes [BR:cef01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CE0053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
56864..57886
Genome map
AA seq 340 aa AA seqDB search
MTTFRAALVESFDADIAVKDVERPTPGPNQALVKLIASGICHTDLHAAKGDWPVLPEPPF
IPGHEGIGEIVELGPGEHDVAVGDIVGNAWLWSACANCEFCRTGRETFCPNAQYGGYTQN
GSFGEYMLVDTRFAPRIPDGVDYLEAAPILCAGVTVYKALKVSNIRPGQFMVISGIGGLG
HIAVQYAKAMGMRPIAVDIADSKLELAKSLGAEFTVNARDVDPAEAVREFTNGGAHGVLV
TAVHEKAFGQALGMARTNGTIVFNGLPPGEFPVSVFDVVFRGLTITGSLVGTRQDMEEAL
DFYARGLIKPKVAECGLDDVADVFEKLESGGIDGRVAIRY
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaccactttccgagctgccctcgtcgagtccttcgacgccgacattgccgtcaaggac
gttgaacgccccaccccggggccgaaccaggccctggtcaagctcatcgcctccggcatt
tgccacacggaccttcatgccgccaagggtgactggcccgtgctgcctgagccaccgttc
atcccgggccatgagggcatcggagagatcgtcgaactcgggcccggcgagcatgacgtt
gcggtgggggacatcgtcggtaatgcgtggctctggtccgcctgcgctaactgcgagttc
tgccgcactggtcgcgagactttctgcccgaacgcgcagtacggcggttacacccagaac
ggctccttcggtgagtacatgctcgtggatacgcgctttgcgccccgcatcccggatggt
gtggactatctcgaggccgccccgattctctgtgctggtgtgacggtgtataaggcgttg
aaggtatcgaatatccggccgggccagttcatggtcatctccggtatcggcggcctgggc
cacatcgccgtccagtacgccaaggcgatgggcatgcgccccatcgcggtggatatcgcc
gactccaagctggaactggcaaagtcactcggtgcggagttcaccgtcaacgcgagggat
gttgacccggccgaggcggtccgggagttcacaaatggtggcgcacacggtgtgcttgtc
accgcggtccatgagaaggcgttcggccaggctctcggtatggcgcgcaccaacggcacc
attgtgttcaatggcctgccgccaggggagttcccggtctcggtctttgatgttgttttc
cggggtttgaccatcaccggttccctggtgggtacccgccaggacatggaggaggcgctg
gacttctacgcccgcggcctgatcaagccgaaggttgccgagtgcgggcttgacgacgtc
gccgatgtcttcgagaagctcgagagtggcggcatcgacggtcgtgtggcgatccgctac
taa

DBGET integrated database retrieval system