KEGG   Corynebacterium efficiens: CE0211Help
Entry
CE0211            CDS       T00103                                 

Definition
(GenBank) putative recombination protein
  KO
K06187  
recombination protein RecR
Organism
cef  Corynebacterium efficiens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cef00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CE0211
DNA repair and recombination proteins [BR:cef03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     CE0211
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CE0211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
225152..225808
Genome map
AA seq 218 aa AA seqDB search
MFEGPLQDLIDELSRLPGVGPKSAQRIAFHLLNVDPDDITRLQDALGAVRDGVRFCRICC
NISRDEVCRICNDSGRDRGLICVVEEPKDIQVIERTGEFRGRYHVLGGALDPLANVGPRE
LTISTLLQRIGGVLDDRELADSTPDTPLLDDKPQIHEVILATDPNTEGEATASYLARLLQ
DFPDLVVSRLASGMPLGGDLEFVDELTLSRALSGRLPL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgaaggccctcttcaggatctcatcgatgaactctcccgactccccggtgtcggc
ccgaagagtgcccagcgcatcgcattccacctgctcaacgtcgatcccgacgacatcacc
cgcctccaggacgccctcggggcggtgcgtgacggcgtacgtttctgccgtatctgctgc
aacatctcccgcgatgaggtctgccgcatctgcaacgactccggtcgtgaccgtggcctc
atctgcgtcgtcgaggaaccgaaggacatccaggtcatagagcgcaccggcgaattccgt
ggccgctaccacgtcctcggcggcgccctcgaccccctggccaatgtcggcccgcgtgag
ctgaccatctccaccctgctccagcgcatcggcggcgtcctcgacgaccgcgagctcgcc
gactccacccccgacaccccgcttctcgacgacaaaccccaaatccatgaggtcatcctc
gccaccgaccccaacactgagggcgaggcgaccgcctcctacctggcccgcctcctccag
gacttccccgacctcgttgtctcccggctggcctccggcatgccgctgggtggcgacctc
gaattcgtcgatgagctcaccctgtcccgcgctctgagcggccgcctgcctctctag

DBGET integrated database retrieval system