KEGG   Corynebacterium efficiens: CE0281Help
Entry
CE0281            CDS       T00103                                 

Definition
copper-transporting ATPase
Orthology
K01533  
Cu2+-exporting ATPase [EC:3.6.3.4]
Organism
cef  Corynebacterium efficiens
Brite
Enzymes [BR:cef01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.4  Cu2+-exporting ATPase
     CE0281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
307275..309254
Genome map
AA seq 659 aa AA seqDB search
MVFFSPMVAHLLGYTIPEFPGASWIAPILGTVVFIYGGDPFLRGGWAELKARQPGMMLLI
SMAITVAFVASWVTTLGIGGFDLDFWWELVLLVTIMLLGHWMEMRALGSASSALDALAAL
LPDEAEKIIDGAVHTVPLAELAEGDVVLVRPGARVPADGTIIDGAAEFDEAMITGESRPV
FRDTGDRVVAGTVATDNTVRVRVESVGEDTALAGIQRMVADAQSSSSRAQALADRAAGWL
FWFALIAGIITAIVWTIIGSPDQAVVRTVTVLIIACPHALGLAIPLVIAISTERAARSGL
LIKDRLALERMRTVDVVLFDKTGTLTEGAHAVTDVAAAAGVSTGQLLAVAAAAEADSEHP
VARAIVTAAAEHPEAAKQQLGGSNFTAATGRGVRATVEGVDVFVGGPNMLRELELDIPAD
IVDTTDQWAGRGAGVLHVVRDGQIIGAVAVEDRIRPESRATVRALQDRGVKVALITGDAR
QVADAVGQELGIDEVFAEVLPQDKDTKVLELQERGLSVAMVGDGVNDAPALARAEVGVAI
GAGTDVAMESAGVVLASDDPRAVVSMIELSQASYRKMIQNLVWASGYNIVAVPLAAGVLA
PIGFILPPAVGAILMSLSTVIVALNAQLLRRIDLDPARLAPTDAAGEEVLVQSSATATR
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
gtggtgttcttcagcccgatggttgcgcacctgctcggttacaccatcccggagttcccc
ggggcaagctggatcgcccccatcctgggcaccgtggtcttcatctacggcggtgaccca
ttcctccggggtggttgggctgaactgaaggcgcgccaacccggcatgatgttgttgatc
tccatggcgatcaccgtggcgtttgtcgcctcctgggtcaccaccctcggtatcggcggg
tttgacctggacttctggtgggaactggtcctgctggtgaccatcatgttgttggggcac
tggatggagatgcgtgccctgggatcggcgtcctccgcattggacgccctggcagctctc
ctgcccgatgaggcggagaagattatcgacggcgcagtccacaccgtgcctctcgctgag
ctggccgaaggtgacgttgtgctggtgcggcccggggcccgggtgcctgccgacggcacc
atcatcgacggcgcagccgagttcgacgaggcgatgatcaccggcgaatcccgcccggtg
ttccgcgacaccggtgacagggtggtcgccggtacggtggccaccgacaacaccgtccgg
gtccgcgtcgaatccgtcggtgaggacaccgccctcgcgggaatccagcgcatggtggct
gatgcgcagtcctcatcctcgcgcgcgcaggcgctggcggaccgggcagccgggtggttg
ttctggttcgcactgatcgccggaatcatcaccgcgatcgtctggacgatcatcggcagc
ccggaccaggcggtggtgcgtaccgtgaccgtgttgatcatcgcctgcccgcatgccctc
ggcctggcgatccccctggtgatcgccatctccaccgaacgcgccgccaggtcgggactg
ttgatcaaggaccgtctggcacttgagcgcatgcgcaccgttgatgtggtcctgttcgac
aagaccggcaccctgaccgagggggcgcacgcggtcaccgatgtcgccgccgccgcgggc
gtgtccaccggacagttgctggccgtggccgcagccgcggaagcggacagtgagcacccc
gtcgcccgtgcgatcgttacggccgcggcggaacaccccgaggcggcgaagcagcaattg
ggcggtagcaacttcaccgccgcgaccggccgcggggtcagggccaccgtcgagggcgtg
gacgtcttcgtcggcgggccgaacatgctgcgtgaactggaactggacattccggcggac
atcgtcgataccaccgaccagtgggccgggcgcggtgccggagtcctccacgtcgtgcgt
gatggtcagatcatcggagctgtggccgtcgaggacaggatccgtcctgaatcccgcgcc
acggtgcgtgccctgcaggaccgcggggtgaaggtcgccctcatcaccggtgatgcacgc
caggtcgccgacgcggtcgggcaggagctgggtatcgacgaggtcttcgccgaggtgctg
ccccaggacaaggacaccaaggtcctcgaactgcaggaacgtgggttgagcgtggcgatg
gtcggcgacggtgtcaacgacgcccccgccctggcacgggccgaggtgggagtcgcaatc
ggtgcaggtaccgatgtcgccatggaatccgcaggtgtggttctggccagcgatgatccg
cgtgccgtggtgtcgatgattgagctgtcgcaggccagttaccgcaaaatgatccagaac
ctggtgtgggcatcgggctacaacattgtggccgttcccttggctgccggcgtgctcgcg
cccatcggtttcatcctgccgccggcggtcggtgccatcctgatgtccctgtccacggtc
atcgtggcactcaatgcccagctgttgcgccgcatcgacctcgacccggctcgcctggca
ccgacagacgcggcaggggaggaggtgcttgttcagagttccgccaccgcaacccgctga

DBGET integrated database retrieval system