KEGG   Corynebacterium efficiens: CE0343Help
Entry
CE0343            CDS       T00103                                 

Definition
dTDP-4-keto-6-deoxyglucose-3,5-epimerase and dTDP-6-deoxy-L-mannose-dehydrogenase
Orthology
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cef  Corynebacterium efficiens
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CE0343
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CE0343
Enzymes [BR:cef01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.133  dTDP-4-dehydrorhamnose reductase
     CE0343
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     CE0343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(373733..375112)
Genome map
AA seq 459 aa AA seqDB search
MTSFNKELTVRDTAIDGLLIVDFPVHGDNRGWFKENWQRQKMLAVGLPDFGPVQNNMSFN
ATAGTTRGLHAEPWDKFVSVGTGRVFGAWCDLREGSATYGAVVTQEITPDIGVYVPRGVA
NGFQALEDETLYTYLVNDHWSPDAQYSNVNLADPALGIEWPLPLTEMSEKDKNHPMLVDA
TGVPARKVLVTGAGGQLGTALRAVFPDAEFVSRQDLDITSDLSSARPWKQYSAIINAAAY
TAVDKAEGEGRADAWAVNATAVANLAAVARENNLTLVHVSSDYVFDGTAPGEYTEDAPLS
PLGVYGQTKAAGDLAATGAPQHYVVRTSWVIGDGGNFVRTMKSLDARGITPSVVDDQIGR
LSFTQDIAAGIKHLLDTRAAYGTYNLTNSGEPASWADVARMIFRDPAAVTGVSTAEYFVD
KQGAAPRPLNSRLDLGKLTATGFTAPDWRARLADYLEEL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgacctcattcaataaggagttaaccgtccgcgacaccgcgatcgacggcctgctcatt
gtcgatttccccgtccacggcgacaaccgcggctggttcaaggagaactggcagcggcag
aaaatgctagctgtgggcctgcccgatttcggccccgtgcagaacaacatgagtttcaac
gccaccgctggcaccacccgtggcctgcatgccgagccgtgggacaagttcgtctccgtc
ggcaccggccgcgtgttcggtgcgtggtgcgatctgcgggaggggtctgccacctacggc
gcggtggtcacgcaggagattaccccggatatcggcgtctacgtcccgcgcggggtggcc
aacggtttccaggcgctggaggatgagaccctctacacctacctggtcaacgatcactgg
tcgcccgacgcgcagtactccaacgtcaacctcgccgacccggcgctcggcatcgagtgg
ccgctccccctgactgagatgtccgagaaggacaaaaaccaccccatgcttgtcgacgct
accggcgtcccagcccgcaaggttctggtgacgggcgcgggtggccagttgggcaccgcc
ctgcgggcggtgttcccggatgcggagttcgtcagccggcaggatctggacatcacctcc
gacctgagttcggcgcgcccgtggaagcagtactccgcgatcatcaacgctgccgcctac
accgcggtggacaaggccgagggtgagggccgcgcggatgcctgggccgtcaacgccacc
gccgtggcgaacctcgctgcggtggcacgggagaacaacctcaccctggtgcatgtgtcc
tcggattatgtcttcgacggcaccgcacctggtgagtacaccgaagatgcaccgttgtcc
ccactcggggtctacggccagaccaaagcagccggtgacctggctgccaccggcgcaccg
cagcactatgtggtgcgcacctcctgggtgatcggcgatggtggcaacttcgtgcgcacc
atgaaatccctggatgcccgcggtatcaccccatctgtggtggatgatcagatcggtcgc
ctgagcttcacccaggacatcgccgccggcatcaagcacctgctggacacccgtgccgcg
tatggcacatacaacctcaccaactccggggagccggcatcgtgggcggatgtggcgcgg
atgatcttccgtgaccctgctgcggtgacgggagtgagtacggcggagtatttcgtcgat
aagcagggcgccgccccgcgcccgctgaactcgcggctggaccttggcaaactgaccgcg
acggggttcaccgcgccggattggcgcgcacggctggccgactacctggaggagttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system