KEGG   Corynebacterium efficiens: CE0450Help
Entry
CE0450            CDS       T00103                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cef  Corynebacterium efficiens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cef00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
486452..488473
Genome map
AA seq 673 aa AA seqDB search
MVAFDHIGCGSQWEPPGLTGREFVRRPVTSPSGHGQCPSSTAAGPSDMHESLMLIVVGWL
VPSGDGYGFCPGQELEKILMTIAEKAEMADTRGIGTSQVPETTGVETHVARRLVSLVPHE
VPCEELIPGKVIFVGAGPGNPDLLTVRAREVLGKTVRAVTDAQVLSSVRDFVAAELPVPE
DKLKAAEEEYERLCAEAKEGGARRKPPRPAPPTAAEIIEVDHADPEEIARILAEQLAKGG
DVIRLVTGNPLSSDSTLAEITAVSEAGMSFQVVPGMSLPGTVPAFAGIALGSTYTETDVS
GEDVDWDQLASAPQPLVLQARAENLATIATELKTRDLPLELPVSVTVNGTTRMQRTYDTT
LGALAKLDAELPGPLVVTLGEGVSDREKYSWWENRALYGWRVLVPRAKPQAAAMSARLAS
HGAIPQEVPTISVEPPRNPAQMERAIKGIVEGRYQWVVLTSVNAVRAVWDMITEFGLDSR
SFAGVRIAAVGEKTAAEIRALGITPELLPPRNRQNAQGIVDVFPEYIEELDPVGRVLLPR
ADIATDVLVDGLVALGWEVDDVVAYRTVRAAPPSADIRDMIKTGGFDAVCFTSSSTVRNL
VGIAGKPHPRTIIACIGPMTADTARELGLRVDVMPEIAEVPDLVDALADHVADLRAKGEL
PPPRKKRRRRKAS
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgcttttgaccacatcggttgcggatcccagtgggagccgcccggcttgacaggg
cgtgaatttgtgcgccgaccagttacgtccccatccgggcatggtcagtgcccatcatcc
accgcggctgggccgtccgatatgcatgagagcttgatgctgattgtagtcgggtggttg
gtgccgtctggtgatgggtacgggttttgtccgggacaagaactagaaaagatattgatg
actatcgccgagaaggccgagatggctgataccagggggatcggaaccagccaggttccc
gagaccaccggggttgaaacgcacgttgcacgcaggcttgtgtcactggtaccccatgag
gtgccgtgtgaagagctgattccaggcaaggtcatctttgtgggggcgggccccggcaac
ccggatctgttgactgtccgtgcccgcgaggtcctgggcaaaaccgtccgtgccgtcacc
gatgcccaggtgctgtccagcgtgcgggatttcgtcgccgctgagctccccgtcccggag
gacaagctcaaggccgccgaggaggaatacgaacggctgtgcgccgaggcgaaggagggc
ggtgcgcgtcgtaagccaccacgtcccgcgcccccgaccgcagccgagatcatcgaggtc
gaccacgccgacccggaggagatcgcccgcatcctggccgagcagctggccaagggcggc
gatgtcatccgcctggtcaccggcaacccgctgagcagcgacagcaccctggccgagatc
actgccgtgtccgaggccggcatgagcttccaggtggtgcccggcatgtccctgcccggc
accgtccccgccttcgcgggcatcgcccttggctcgacctacaccgaaaccgatgtcagc
ggcgaggatgtcgactgggaccagctggccagcgccccacagcccctggtgctgcaggcc
cgcgccgagaacctggccaccatcgccacggagctgaaaacccgcgatctgcctctggag
ttgccggtatcggtcaccgtcaacggcaccacacgcatgcagcgcacctatgacaccacc
ctcggtgccctggccaagctcgacgcggagctgcccggcccgctcgtggtcaccctcggt
gagggtgtcagcgaccgggagaagtactcctggtgggagaaccgcgccctctacggctgg
cgtgtgctcgtcccccgcgccaagccccaggccgccgccatgagcgcgcgcctggccagc
cacggtgccatcccgcaggaggtcccgacgatctccgtggagccgccacgcaacccggcg
cagatggaacgcgccatcaagggcatcgtcgagggccgttaccagtgggtcgtgctcacc
agcgtcaacgccgtgcgcgccgtctgggacatgatcaccgaattcggcctggattcccgc
tccttcgccggtgtgcgcatcgccgcggtgggggagaagaccgccgccgagatccgcgca
ctgggcatcacccccgagctgctgccaccacgcaaccgccagaacgcccagggcatcgtc
gacgtcttccccgaatacatcgaggagctcgacccggtcggtcgcgtcctgctgccacgt
gcggacatcgcaacggacgtgcttgtcgacgggctggtcgccctcggctgggaagtcgac
gacgtggtcgcctaccggaccgtccgggccgcgcccccgagcgccgacatccgcgacatg
atcaaaaccggtggtttcgatgcggtgtgcttcacttcatcctccaccgtgcgcaacctc
gtcggcatcgccggcaagccccacccgcgcaccatcatcgcctgcatcggcccgatgacc
gcggacaccgcccgcgaactgggcctgcgggtggatgtcatgccagagatcgccgaggtc
cccgacctggtcgacgctctggctgatcacgtcgccgacctccgtgcgaagggtgagctg
ccgcctccgaggaagaagcggcggcgtcgtaaagcgtcttaa

DBGET integrated database retrieval system