KEGG   Corynebacterium efficiens: CE0453Help
Entry
CE0453            CDS       T00103                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cef  Corynebacterium efficiens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CE0453
Enzymes [BR:cef01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CE0453
Exosome [BR:cef04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CE0453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
490741..491760
Genome map
AA seq 339 aa AA seqDB search
MSTPSDYSHHLIRRPRRLRANPAMRELAAETTLRPADLILPMFLADGITEPREITSMPGV
HQHTEDSLLRAVHEALDAGVRCVDLFGVPVDADKDADGSQAWNPEGVLNRGLAAVRKEFG
DDVLVMADTCLDEFTDHGHCGVVTTDRHGAAVVDNDATLPLYQQMAVAQARAGAHIVSPS
GMMDGQIAAIRSALDAEGFQDVAIMAYSAKYASAFFGPFREAVGSSLQGDRRTYQQDPAN
LRESLLEVELDIAEGADFVMVKPALPYLDVLTRVAEISPVPVAAYQVSGEYAMIQAAGRN
GWVDTEAVMMESLISIKRAGANQILTYFATEAARKLNNR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgtccacgccctctgattacagccaccacctgatccgccgtccccgtcgtctgcgcgcc
aacccggcgatgcgggaactggccgccgagaccaccctgcgcccggcggatctgatcctg
ccgatgttcctcgccgacggcatcaccgaaccccgcgagatcacctccatgcccggtgtc
caccagcacaccgaggattccctgctgcgcgccgtgcacgaggcgctcgacgccggggtg
cgctgcgtcgacctgttcggcgtgcctgtcgacgcagacaaggacgccgacggctcccag
gcctggaacccggagggcgtgctcaaccgggggctggccgcggtgcggaaggagttcggc
gatgatgtcctggtcatggccgacacgtgcctggatgagttcaccgaccacggccactgc
ggcgtggtcaccaccgaccgtcacggtgcggccgtggtggacaatgacgccaccctgccc
ctctaccagcagatggccgtggcgcaggcccgcgccggtgcccacatcgtcagcccctcg
ggcatgatggacggccagatcgccgccatccggtccgccctggatgccgagggtttccag
gacgtggccatcatggcctactccgccaagtacgcctccgccttcttcggtcccttccgt
gaggccgtggggtcctccctgcagggcgatcgccgcacctaccagcaggatcccgccaac
ctgcgggaatccctgctcgaggtggaactggacatcgccgagggcgcggacttcgtcatg
gtcaagcccgccctgccgtacctggatgtgctcacccgcgtcgctgagatctcgcccgtg
ccggtggccgcctaccaggtctccggtgaatacgccatgatccaggccgccggacgcaac
ggctgggtggacaccgaagcggtgatgatggaatcgctgatctccatcaaacgcgccggc
gcgaaccagatcctcacctacttcgccaccgaggcggcacggaagctgaacaaccgctga

DBGET integrated database retrieval system