KEGG   Corynebacterium efficiens: CE0459Help
Entry
CE0459            CDS       T00103                                 

Definition
(GenBank) putative protoporphyrinogen oxidase HemY'
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cef  Corynebacterium efficiens
Pathway
cef00860  Porphyrin and chlorophyll metabolism
cef01100  Metabolic pathways
cef01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CE0459
Enzymes [BR:cef01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CE0459
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     CE0459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 FAD_binding_2 HI0933_like Lycopene_cycl Pyr_redox_3 Pyr_redox_2 NAD_binding_9 GIDA Staph_opine_DH
Motif
Other DBs
NCBI-ProteinID: BAC17269
NITE: CE0459
UniProt: Q8FSD5
Position
497109..498506
Genome map
AA seq 465 aa AA seqDB search
MRIAIIGAGLAGLTAAYEIHKAEPDTHIDVLEAGERIGGKLFTVPFASGPTDMGAEAYLA
TRADATELFHELGLGDSLVTPSGARSQIYAGGRLRPMPRGGVMGIPSSSAGLEEILSEET
RTLIDAEAGTAPVDWQVGGDASVGALVRARYSDEVADVLVSALLGGVYSSSADDLGIRAT
VPALAEALDRLAESGEPVTLSGAVKLVETERAEARKNSETTPVFQTFRGGYAELYEALAD
QCGADIHLDTFVSGITQVNGGGFQIKGGGEGTYDRVILAVPAPTAAVLLREVAPGATEHL
KTIQLASSAVVGMRFDSAEGLPDVSGVLVASGEPAITAKAFTFSSKKWPHLGERGGALVR
ASFGRLGDEATARMDEDNLVDAALDDLQTITGFDGRAAGLSEIFVQRWFGGLPNYGVDHI
ATVARARTEISQVKGLEAIGAWASGVGVPAVIADAKAAVERLLDA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgccatcatcggcgcgggtctcgctggcctgaccgccgcctatgagatccac
aaggccgaaccggatacccacatcgatgtcctggaggcgggtgaacgcatcggtggcaaa
ctcttcaccgtcccgttcgcatccggccccaccgacatgggtgcggaggcctacctggcc
acccgcgccgatgccaccgagctcttccatgaactcggcctcggcgattcactggtgacc
ccgtcgggcgcccgctcgcagatctatgccggtgggcgcctgcgccccatgccgcgcggc
ggtgtcatgggcatcccgtcctcctccgcgggcctggaggagatcctctccgaggagacc
cggacgcttatcgacgctgaagccggcaccgccccagtcgactggcaggtcggcggggac
gcctccgtgggcgcgctggtgcgcgccaggtactccgatgaggtcgccgatgtgctggtc
tccgcgctgctgggtggggtgtactcctcctcagccgacgacctgggcatccgggcaacc
gtcccggccctggccgaggcactcgaccgcctggcggagtccggtgagcccgtcaccctg
agtggtgcggtgaaactcgtggagactgaacgcgccgaggcgcggaagaactccgagacc
accccggtgttccagaccttccgcggtggttatgccgaactctatgaggccctggccgat
cagtgcggtgccgacatccacctcgacacctttgtctccggcatcacccaggtcaacggc
ggcggtttccagatcaagggtgggggagagggcacctatgaccgggtgatcctcgccgta
cccgcccccaccgcggcggtcctgctgcgggaggtcgcaccgggtgccaccgagcacctc
aagaccatccagctggcctcctccgcggtggtcggcatgcgctttgactccgccgagggg
ctgccggatgtctccggcgtgctggtggccagcggggagccggccatcaccgccaaggca
ttcaccttctcctcgaagaagtggccccacctgggcgaacggggtggcgcgctggtgcgc
gcgtccttcggacggcttggcgacgaggccaccgcccgcatggatgaggacaacctggtg
gatgcggccctggatgatctccagaccatcaccggtttcgacggtcgcgccgccggcctg
tccgagatcttcgtccaacggtggttcgggggtctgccgaactatggtgttgaccacatc
gccaccgtcgcccgggcacgcacagagatttcccaggttaagggtctggaagccattgga
gcttgggcttccggtgtgggagtgcccgccgtcatcgccgatgcgaaggctgcagtcgaa
cgactgctcgatgcatag

DBGET integrated database retrieval system