KEGG   Corynebacterium efficiens: CE0620Help
Entry
CE0620            CDS       T00103                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cef  Corynebacterium efficiens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CE0620
   00052 Galactose metabolism
    CE0620
   00500 Starch and sucrose metabolism
    CE0620
   00520 Amino sugar and nucleotide sugar metabolism
    CE0620
Enzymes [BR:cef01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CE0620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(660000..660959)
Genome map
AA seq 319 aa AA seqDB search
MVTAHTDSAHSTPLRTVVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAEEAAEAGA
QRLAVITAPAKDGILAHFGDFTELRDHLVTKGKTAEAAKVARAVEIITVQGVVQEEPLGL
GHAVSLAEGALDDNEEIFAVMLPDDLVLPIGVTSQMIRVQEQFGGTVLCAMDVPLEEVSK
YGVFDIADIPGQPGVKQVLGMVEKPSQEKAPSTFVATGRYVFDRHIFDALRRTTPGKGGE
IQLTDAIDLLIREGHPVHILVHEGQRHDLGNPGGYIIACMELGMEHPVYGASIREAVTRA
AAALAPATLASVQPLTSSS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggtcacagcacatactgattccgcacacagcacccccttgcgcaccgttgtcgttccg
gcggcgggcctggggacacgtttcctcccggccaccaagacagtgcccaaggagctgctg
ccggtggtggacacccccggcattgaactggttgccgaggaggccgccgaggccggcgcc
cagcgactggcggtcatcaccgcccccgccaaggacggtatcctcgcccatttcggcgac
ttcaccgagctgcgggaccacctggtaaccaagggcaaaaccgcggaggctgccaaggtt
gcgcgggctgtggagatcatcaccgtccagggtgtggtccaggaggaacccctcggcctc
gggcatgcggtcagcctcgcggagggtgccctggatgataatgaagagatcttcgccgtc
atgctccccgacgatctcgtcctgcccatcggtgtcacctcccagatgatccgggtccag
gagcagttcggtggaacggtactgtgtgccatggatgtacccctggaggaggtgtccaaa
tacggtgtcttcgacatcgcggacatccccggccagcccggcgtcaagcaggtgctgggc
atggtggagaaaccctcacaggagaaggcaccctccaccttcgtggccaccggccgctat
gtcttcgaccgtcatatcttcgatgcgctgcggcgcaccaccccgggcaagggtggggag
atccagttgaccgacgccattgatctgctcatccgggagggccacccggtacacatcctt
gtccacgaggggcagcgtcatgacctgggcaatccgggtggctacatcatcgcctgcatg
gagctcggcatggaacaccccgtctacggtgcctccatccgggaggccgtcacccgcgcc
gcggcggcactcgccccggcgacactcgcctcggtgcaaccgctcacatcgtcatcgtga

DBGET integrated database retrieval system