KEGG   Corynebacterium efficiens: CE1105Help
Entry
CE1105            CDS       T00103                                 

Definition
magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cef  Corynebacterium efficiens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cef00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1164965..1166413)
Genome map
AA seq 482 aa AA seqDB search
MNPQHDMTPDNSPGSAPASASSTPPAAATLGELKATGYTHRPVREEIRDNLLAKLAAGED
PWPGLHGLQHTVIPQVERALIAGHDIVLLGERGQGKTRLLRSLAMLLDEWIPAVADTDLR
EDPLAPITEATRLRVELEGDDLPIVWVHREDRYAEKLATPDTSVADLIGDVDPMRVAEGR
RLGDPETIHYGLIPRSNRGLVAINELPDLAERIQVAMLNVMEERDVQIRGYMLRLPLDVL
VVASANPEDYTNRGRIITPLKDRFGAEIRTHYPLALEDEIAVITQEADLVAEIPPVLLEI
LARYTRALRESPAVNQRSGVSARFSIAGAETVAAAALRRATIRGEDTAVARLVDLEAAVD
VLSGKIEFESGEEGREWETLEYLLRTATAEAIRSHLRGVDFTPLITALDGSVTVSTGEQV
TAEEFLAGLPELGESDLYDKVADIFGATTPGTRAAAIELALEGLYLSRKIAKDSGEGETI
YG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcctcagcatgatatgacccccgacaactcccccggcagcgctcccgccagcgcc
tccagcacccctcccgctgccgccacgctcggtgagctcaaggccaccgggtacacccac
cggccggtgcgcgaggagatccgcgacaacctgctggccaaactcgccgcgggcgaggat
ccctggcccggtctgcacggtctgcagcacacggtgatcccgcaggtggagcgcgccctg
atcgccggtcatgacatcgttctgctcggcgaacgtggtcagggcaagacccgcctgctg
cggtccctggcgatgcttctcgacgagtggatccccgccgtcgccgacaccgatctgcgt
gaggatcccctggcccccatcaccgaggccacccgcctgcgggtggaactggaaggcgat
gacctgcccatcgtgtgggtgcaccgcgaggaccgttatgccgagaaactggccaccccg
gatacctcggtggccgacctcatcggtgacgtggatcccatgcgggtggccgagggacgc
cgcctgggcgacccggagaccatccactacggtctgatcccacggtccaaccgtggcctg
gtggccatcaatgagctgcccgacctcgccgagcgcatccaggtagccatgctcaatgtc
atggaggaacgcgatgtgcagatccgcggctacatgctgcgcctgccgctggatgtactc
gtggtggcctcggccaacccggaggactacaccaaccgcgggcgcatcatcaccccgctc
aaggaccgcttcggcgcggagatccgcacccactacccgctcgccctggaggatgagatc
gcggtgatcacccaggaggcggacctggtcgcagagattccccccgttctgttggagatc
ctcgcccgttacacccgcgcgctgcgggaatcccccgcggtgaaccagcgttccggtgtc
tcggcgcgtttctccatcgccggggcggagaccgtcgccgccgccgccctgcgccgcgcc
accatccgcggtgaggatacggccgtggcccgcctggtggatctggaggccgccgtggat
gtgctcagcggcaagatcgaattcgagtccggtgaggagggccgcgagtgggagaccctg
gaatacctgctgcgtaccgccaccgccgaggccatccgctcccatctgcgtggggtggat
ttcaccccgctgatcaccgccctggatgggtcggtcaccgtctccacgggtgagcaggtc
accgccgaggagttcctcgctggcctgccggaactgggcgagtcggatctctacgacaaa
gtcgccgacatcttcggggccaccacccccggcacccgcgccgcggccatcgaattggcc
ctcgagggcctctatctctcccggaagattgccaaggattccggcgagggcgaaaccatc
tacggataa

DBGET integrated database retrieval system