KEGG   Corynebacterium efficiens: CE1348Help
Entry
CE1348            CDS       T00103                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cef  Corynebacterium efficiens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CE1348
   01230 Biosynthesis of amino acids
    CE1348
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CE1348
   00030 Pentose phosphate pathway
    CE1348
   00051 Fructose and mannose metabolism
    CE1348
   00052 Galactose metabolism
    CE1348
  Energy metabolism
   00680 Methane metabolism
    CE1348
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CE1348
Enzymes [BR:cef01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CE1348
Protein phosphatases and associated proteins [BR:cef01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CE1348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1413251..1414291
Genome map
AA seq 346 aa AA seqDB search
MGAMRIATLTSGGDCPGLNAVIRGIVRTASNEFGSTVVGYQDGWEGLLADRRVQLYDDED
IDRILLRGGTILGTGRLHPDKFRAGIDQVKANLADAGIDALIPIGGEGTLKGAKWLADNG
IPVVGVPKTIDNDVNGTDFTFGFDSAVSVATDAIDRLHTTAESHNRVMIVEVMGRHVGWI
ALHAGMAGGAHYTVIPEVPFDISEICKRMERRFQMGEKYGIIVVAEGALPKEGTMELREG
EVDQFGHKTFTGIGQQIADEVHRRLGHDVRTTVLGHIQRGGTPTAFDRVLATRYGVRAAR
ACHEGQFNTVVALKGERIRMISFDEAVGTLKKVPMERWVTAQAMFG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgggagccatgcgaattgccactctcacgtcaggcggcgactgccccggactcaatgct
gtcatcaggggaatcgtccgtaccgcaagtaatgaattcggttccaccgtcgtgggttat
caggacggctgggagggcctgctggcggaccgacgtgttcagctctatgacgatgaggac
atcgaccgcatcctgctccgcggtggaacaatcctgggcaccggtcgtctccaccccgac
aagttcagagccggaatcgaccaggtcaaggcgaatctcgccgatgcgggaattgacgca
ctcatcccgatcggtggcgagggcaccctcaagggagcgaagtggctcgccgacaacggc
atccccgtggtcggtgtcccgaaaaccatcgacaatgatgtcaacggcacggatttcacc
ttcggtttcgattccgcggtctctgtggccaccgacgccatcgaccggctgcacaccacg
gcggaatcccacaaccgtgtgatgatcgtcgaggtcatgggccgccacgtcggttggatc
gcactgcatgccggcatggccggtggagcccactacaccgtcatccccgaggtgcccttc
gacatctcggagatctgcaagcgtatggaacgtcgcttccagatgggggagaagtacggc
atcatcgtcgtcgcggagggtgccctgcccaaggagggaaccatggagctgcgtgagggg
gaggtggatcagttcggtcacaagaccttcaccggcatcggccagcagatcgccgacgag
gtgcacaggcgtctgggtcatgatgtccgcaccacggtcctgggccatatccagcgtggt
ggcacccccaccgccttcgaccgtgtcctggccacccggtacggtgtccgcgccgcgcgt
gcctgccacgagggtcagttcaacaccgtggtcgcgctcaagggggagcgcatccggatg
atctccttcgatgaggccgtgggcaccctgaagaaggtgccgatggaacgctgggtgacc
gcccaggctatgttcggttag

DBGET integrated database retrieval system