KEGG   Corynebacterium efficiens: CE1696Help
Entry
CE1696            CDS       T00103                                 

Definition
glucose-6-phosphate 1-dehydrogenase (EC:1.1.1.49)
Orthology
K00036  
glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49]
Organism
cef  Corynebacterium efficiens
Pathway
Pentose phosphate pathway
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:cef01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cef00030]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cef00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1784897..1786441
Genome map
AA seq 514 aa AA seqDB search
MSSHTNPTTWINPLRDPQDKRLPRIAGPSGLVIFGVTGDLARKKLLPAIYDLANRGLLPP
GFALVGYGRRDWSKEDFENYVREAVEAGARTEFRGNVWERLAEGMEFVKGNFDDDSAFDN
LADTLKRLDETRGTAGNWAFYLSIPPDSFAAVCHQLERSGMAASTDESWRRVIIEKPFGN
DLKTAHELNETVNAVFPEESVFRIDHYLGKETVQNILALRFANQLFEPLWNSNYVDHVQI
TMAEDIGLGGRAGYYDGIGAARDVIQNHLIQLLALVAMEEPISFTPTQLQAEKIKVLRAT
KPSLPIAENSARGQYSAGWQGSEYVKGLREEDGFDPESTTETYAACTLEITSRRWAGVPF
YLRTGKRLGRRVTEIAVVFKDAPHQPFDPGMTAALGNNAIVIRVQPDEGVLIRFGSKVPG
SAMEVRDVNMDFSYSESFTEESPEAYERLILDALLDESSLFPTNEEVELSWKILDPILEI
WEENGQPEEYPAGTWGPKSADEMLARNGHQWRRP
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtgagctcccacacgaatcccaccacctggattaatcccctgcgtgatccccaggacaaa
cgactgccccgcatcgcgggaccgtccggcctggtcatcttcggtgtcaccggtgacctc
gcccgcaagaagctcctccccgcgatctatgatctggccaaccgtggtctgctccccccg
ggtttcgccctggtgggttacggacgccgtgactggagcaaggaggacttcgagaactac
gtgcgcgaggccgtggaggccggcgcccgtaccgaattccgcggaaacgtgtgggaacgc
ctcgccgagggcatggaatttgtcaagggcaacttcgacgacgattccgccttcgacaat
ctcgcggacacgcttaagcgtctcgacgagaccaggggcaccgccggcaactgggccttc
tacctatccatcccgccggattccttcgcggcggtctgccaccagttggagcgctcaggt
atggcggcatccacagacgaatcctggcgacgggtgatcatcgagaagcccttcggcaat
gatctcaagaccgcgcatgaactcaatgagacggtcaacgctgtcttccccgaggaatcg
gtcttccgcatcgaccattacctgggcaaggaaaccgtccagaacattctggccctgcgt
ttcgccaaccagctgttcgagccgttgtggaactccaattatgtcgatcatgtgcagatc
accatggcggaggacatcggattggggggacgcgccggttattatgacggcatcggtgcc
gcccgtgatgtcatccagaaccacctgatccagctgctggccctggtggccatggaggag
cccatctccttcacccccacccagctgcaggcagagaagatcaaggtgcttcgtgccacc
aagccgagcctgccgatcgcggagaactccgcgcgtggccagtattccgccggctggcag
gggtctgaatatgtcaagggtctgcgggaggaggatggtttcgatccggaatccaccacc
gagacctatgccgcctgcaccctggagatcacctcccgcaggtgggcgggtgtgccgttc
tacctgcgcaccggcaaacgcctgggtcgtcgtgtcaccgagatcgccgtggtgttcaag
gatgccccccaccagcccttcgatcccggcatgaccgcggcactcggtaacaacgccatc
gtgatccgtgtgcagcccgacgagggtgtgctcatccgtttcggatccaaggtgcccgga
tctgccatggaggtccgtgatgtgaatatggacttctcctattccgagtccttcaccgag
gaatcccccgaggcgtatgagcgtctcatcctggatgcgcttctcgatgagtccagcctc
ttccccaccaatgaggaagtggaactgagctggaagatcctggatccgatcctggagatc
tgggaggagaatggccaaccggaggagtatcccgccggcacatggggaccgaagagcgcc
gatgagatgctggcacgcaacggccaccagtggcgcaggccgtag

DBGET integrated database retrieval system