KEGG   Corynebacterium efficiens: CE1704Help
Entry
CE1704            CDS       T00103                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cef  Corynebacterium efficiens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CE1704 (tpiA)
   01230 Biosynthesis of amino acids
    CE1704 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CE1704 (tpiA)
   00051 Fructose and mannose metabolism
    CE1704 (tpiA)
   00562 Inositol phosphate metabolism
    CE1704 (tpiA)
Enzymes [BR:cef01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CE1704 (tpiA)
Exosome [BR:cef04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CE1704 (tpiA)
  Exosomal proteins of bladder cancer cells
   CE1704 (tpiA)
  Exosomal proteins of melanoma cells
   CE1704 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1795195..1795983)
Genome map
AA seq 262 aa AA seqDB search
MSPMARKPLIAGNWKMNLDHQQAIGTVQKLAFALHKDYYEKVDVAVIVPFTDLRSVQTLV
EGDKLQITYGAQDVSQHESGAYTGEVSASMLAKLNCSWVVVGHSERREYHNETDELVAAK
AKAALSKGISPIVCVGEPLEIREAGTHVDYVVEQTRASLAGLSADELANTVIAYEPVWAI
GTGKVASAADAQEVCKAIRGLVTELAGEEVAEGMRILYGGSVKAETIAEIVSQPDVDGGL
VGGASLDGEAFAKLAANAANAV
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgtcacccatggcacgtaaaccactcatcgccggtaactggaagatgaacctggatcac
cagcaggccatcggaacggtccagaagctcgcattcgccctgcacaaggactactacgag
aaggtcgacgtggcggtgatcgtcccctttaccgatctgcgctccgtccagaccctggtg
gagggtgacaagctgcagatcacctacggtgcgcaggatgtctcccagcacgagtccggt
gcctacaccggtgaggtgtccgcctccatgctggcgaagctgaactgttcctgggttgtc
gtcgggcattccgagcgacgcgagtaccacaatgaaaccgatgagctcgtggcggcgaag
gccaaggctgcgctcagcaagggcatcagcccgatcgtctgtgtcggcgagccacttgag
atccgcgaggcgggaacccatgtggactacgtggtcgagcagacccgcgcatccctcgcc
ggtctgagtgccgatgagctggccaacactgtcatcgcctacgagcccgtctgggccatc
ggaaccggtaaggtcgcctccgcagccgacgcgcaggaggtctgcaaggccatccgcggc
ctggtcaccgagctcgccggcgaggaggtcgcagaaggaatgcgcattctctacggtggc
tccgtgaaggcggagaccatcgccgagatcgtcagccagcccgatgtggatggtggcctc
gtaggtggggcctccctcgatggtgaggctttcgccaaactcgccgcgaatgcggccaac
gccgtctag

DBGET integrated database retrieval system