KEGG   Corynebacterium efficiens: CE1704Help
Entry
CE1704            CDS       T00103                                 

Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cef  Corynebacterium efficiens
Pathway
cef00010  Glycolysis / Gluconeogenesis
cef00051  Fructose and mannose metabolism
cef00562  Inositol phosphate metabolism
cef01100  Metabolic pathways
cef01110  Biosynthesis of secondary metabolites
cef01120  Microbial metabolism in diverse environments
cef01130  Biosynthesis of antibiotics
cef01200  Carbon metabolism
cef01230  Biosynthesis of amino acids
Module
cef_M00002  Glycolysis, core module involving three-carbon compounds
cef_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CE1704
   00051 Fructose and mannose metabolism
    CE1704
   00562 Inositol phosphate metabolism
    CE1704
Enzymes [BR:cef01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CE1704
Exosome [BR:cef04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CE1704
  Exosomal proteins of bladder cancer cells
   CE1704
  Exosomal proteins of melanoma cells
   CE1704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAC18514
NITE: CE1704
UniProt: Q8FT67
Position
complement(1795195..1795983)
Genome map
AA seq 262 aa AA seqDB search
MSPMARKPLIAGNWKMNLDHQQAIGTVQKLAFALHKDYYEKVDVAVIVPFTDLRSVQTLV
EGDKLQITYGAQDVSQHESGAYTGEVSASMLAKLNCSWVVVGHSERREYHNETDELVAAK
AKAALSKGISPIVCVGEPLEIREAGTHVDYVVEQTRASLAGLSADELANTVIAYEPVWAI
GTGKVASAADAQEVCKAIRGLVTELAGEEVAEGMRILYGGSVKAETIAEIVSQPDVDGGL
VGGASLDGEAFAKLAANAANAV
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgtcacccatggcacgtaaaccactcatcgccggtaactggaagatgaacctggatcac
cagcaggccatcggaacggtccagaagctcgcattcgccctgcacaaggactactacgag
aaggtcgacgtggcggtgatcgtcccctttaccgatctgcgctccgtccagaccctggtg
gagggtgacaagctgcagatcacctacggtgcgcaggatgtctcccagcacgagtccggt
gcctacaccggtgaggtgtccgcctccatgctggcgaagctgaactgttcctgggttgtc
gtcgggcattccgagcgacgcgagtaccacaatgaaaccgatgagctcgtggcggcgaag
gccaaggctgcgctcagcaagggcatcagcccgatcgtctgtgtcggcgagccacttgag
atccgcgaggcgggaacccatgtggactacgtggtcgagcagacccgcgcatccctcgcc
ggtctgagtgccgatgagctggccaacactgtcatcgcctacgagcccgtctgggccatc
ggaaccggtaaggtcgcctccgcagccgacgcgcaggaggtctgcaaggccatccgcggc
ctggtcaccgagctcgccggcgaggaggtcgcagaaggaatgcgcattctctacggtggc
tccgtgaaggcggagaccatcgccgagatcgtcagccagcccgatgtggatggtggcctc
gtaggtggggcctccctcgatggtgaggctttcgccaaactcgccgcgaatgcggccaac
gccgtctag

DBGET integrated database retrieval system