KEGG   Corynebacterium efficiens: CE1756Help
Entry
CE1756            CDS       T00103                                 

Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
cef  Corynebacterium efficiens
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    CE1756
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CE1756
Enzymes [BR:cef01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     CE1756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1851812..1853059
Genome map
AA seq 415 aa AA seqDB search
MHIRQNIYALTDEQLERFQDAVNGIKADGTYDHFTEQHHHSMHEATVFPWESGGHLLRNS
AHRGPAFLPWHRYYCREFELALQEKDPSVPLPYWDWAADSAAGAAAPLWNTDPDRGRIYI
GGNGTGPDSTVNTGPFAGWEVLVEWGMGFTRRPGGLRRQLGLAVPTLPTPDEVTACITDL
PVYDTDPWHPGSADSFRNQLEGWPNGPAMHNRVHVWVGGDMGPGTSPNDPVFYLHHAFVD
LIWARWQQTHAGGYLPDGQGPPGHNLHDEMAYLDSTSPTPANCLDYRHSMGYIYDTDPPT
VQQMTSALDFTNVMAGDVERRYALFHARAAQPVTFEVLPTRGLQAPYSLFHTEPTIIHEP
VVDNRPYDEVRIWFAFTADLTPGPAPAGSAQVRCRETDEIFEISLTGSTRELSVR
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtgcacatcaggcagaacatctacgcactcaccgatgagcagctggagcggtttcaggat
gcggtgaacgggatcaaggcggatggtacctacgaccatttcaccgaacagcaccaccac
tccatgcacgaggccaccgtgttcccctgggaatcaggcgggcacctgttgcggaactcg
gcccaccgcggtccggcgttcctgccatggcaccgttattactgtcgggaattcgaactg
gccctgcaggagaaggatccatcggtgcccctgccctactgggactgggccgctgattcc
gccgccggggccgccgcaccattgtggaacactgatccggaccgtggccgcatctacatc
ggcggcaatggtaccggccccgattccaccgtgaacaccggcccgttcgccgggtgggag
gtcctggtggaatggggcatggggttcacccggcgccccggcgggttgaggcgccagttg
ggcctggcggtgcccacgcttccgaccccggatgaggtgacggcctgcatcaccgatctg
ccggtgtatgacaccgacccgtggcacccgggcagtgcggacagttttcgtaatcagctg
gagggatggcccaacgggcccgcgatgcacaaccgggtccacgtgtgggttggtggcgac
atggggccgggcacctccccgaatgatccggtgttctacctgcaccacgctttcgtcgac
ctgatctgggcccgctggcagcagacccacgccgggggttatctcccggatgggcagggg
cctccgggacacaatctccacgatgagatggcttatctggactcgacctcacccaccccc
gcgaactgcctggattaccgccattccatgggctatatctacgacacggatccgcccacg
gtgcagcagatgacctctgccctcgacttcaccaatgtgatggccggggatgtggaacgc
cgctacgcgctctttcatgccagggcggcacaacccgtcaccttcgaggtgctgcccacc
cgtgggttacaggcaccctattccctcttccacaccgaaccgacgatcatccacgaaccg
gtggtggacaaccgcccctacgatgaggtgcgcatctggttcgcgttcaccgccgacctg
acaccagggcccgcacccgccgggtccgcgcaggtccggtgcagggaaaccgatgagatc
ttcgagatctccctgaccgggtccacgagggagctgagcgttcgatag

DBGET integrated database retrieval system