KEGG   Corynebacterium efficiens: CE1774Help
Entry
CE1774            CDS       T00103                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cef  Corynebacterium efficiens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cef00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CE1774 (ruvA)
Enzymes [BR:cef01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CE1774 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1872256..1872870)
Genome map
AA seq 204 aa AA seqDB search
MIASLRGTVISIGLGTAVIECQGVGYEVTTTPTTLARLQRGEEATLLTTMVVREDAMKLY
GFIDDQSREMFALLQTVTGLGPRLALACESVLTPLEIAQAIAGGDAKTLQRVPGVGKRMA
DRLIVELKDKVAAYTVGVVDDGAPTAPTQGVAPVVVVDQVTQALTGLGFTEKQADDAVAA
VLSADPGLDTSAALRAALAKLGGK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcctcattgcgcggaaccgtcatcagcattgggctggggacggcggttattgaa
tgccagggggtcggctatgaagtgaccaccacacccaccaccctcgcccgcctgcagcgc
ggtgaggaggcaaccctgctgaccaccatggtcgtgcgggaggatgccatgaaactctac
gggttcatcgatgaccagtcccgggagatgttcgcgctgctgcagaccgtcaccggcctc
gggccacgtctggcgctggcctgtgaatccgtgctcacccccctcgagatcgcccaggcg
atcgccggcggtgacgccaaaaccctccagcgtgtcccaggcgtgggtaaacgcatggca
gaccgtctcatcgtggagctgaaggacaaggtcgcggcctacaccgtgggcgtggtcgat
gacggtgcccccacggcccccacccagggggtggcccctgtcgtggtcgtggatcaggtg
acccaggccctgaccggattgggtttcaccgagaaacaggcagatgatgcggtggccgcc
gtcctgtcggccgatccgggtctggacacctcggcggcgctgcgtgccgccctggccaaa
ctcggcgggaaatag

DBGET integrated database retrieval system