KEGG   Corynebacterium efficiens: CE1803Help
Entry
CE1803            CDS       T00103                                 

Definition
polyphosphate glucokinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
cef  Corynebacterium efficiens
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:cef01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cef00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cef00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1900488..1901297
Genome map
AA seq 269 aa AA seqDB search
MTSAAVFLPDSLLVCTLGRMTETGFGIDIGGSGIKGARVDLSTGEFIGDRIKISTPKPAT
PDAVAEVVTEILAEAQWDGPVGITVPAVVRGQVALTAANIDKAWIGTDVHELFHRHLGDR
EITVLNDADAAGIAEATFGHPDARKRSVILLTFGTGIGSAFLMDGELFPNTELGHLIVDD
MEAEHRASGAVKDNKDLSWKEWAAEVSRVLNEYERLFYPSLFIVGGGISRKHKKWVPLLD
VKTEVVPAELRNRAGIVGAAMAVAKHLAP
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacctctgcagctgttttcctgccggattccctgttggtttgtacacttgggcgcatg
actgaaacgggatttggaatcgatattggtggttccggcatcaagggtgcacgggtcgac
ctgtccaccggtgagttcatcggcgatcggataaagatctccacccccaagcccgcaacg
cctgacgccgtcgctgaggtggtcacagagatcctcgcggaagcgcagtgggatggaccg
gtgggcatcacggttcccgccgtggtgcgtggacaggtggcgctcactgccgccaacatc
gataaggcgtggattggcacggatgtccacgagctgttccaccggcacctgggtgatcgg
gagatcaccgtgctcaacgatgcggatgcagcgggcatcgccgaagccacgttcgggcac
cccgatgcacgcaagagatcagtcatcctcctgaccttcggaaccggtatcggatcagct
tttctcatggatggtgagcttttccccaacacagagctgggacatctcattgtcgatgac
atggaagcagagcaccgcgcctccggggctgtcaaggacaacaaggacctctcctggaag
gagtgggccgctgaggtcagcagggtactcaacgagtatgagcgcctcttctaccccagt
ttgttcatcgtgggcggtgggatctcccggaaacataagaagtgggttccactcctcgat
gtcaaaacggaggtcgttccggcggagctgcgtaatcgcgcgggtatcgtcggggcggcg
atggcggtggcaaaacacctggccccctag

DBGET integrated database retrieval system