KEGG   Corynebacterium efficiens: CE1891Help
Entry
CE1891            CDS       T00103                                 

Definition
protoporphyrin IX magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cef  Corynebacterium efficiens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CE1891
Enzymes [BR:cef01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     CE1891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1998633..1999772)
Genome map
AA seq 379 aa AA seqDB search
MPVTRKASDYPMSTNQVLRYPFSAVVGQDELRLALILTAISPRIGGVVVRGEKGTAKTTT
VRAFAGLLGDAPLINLPLGATEDRVVGSLNMETVLTTGRAEYKPGLLAQADGGVLYVDEV
NLLADHLVDALLDAAASGRVSIERDGISHSSPANFVLVGTMNPEEGELRPQLLDRFGLAV
DVVASNNPEIRVEIIQRRLAYEANPEQFVQDWAAQDEEISQRIHTARQLLPNVELPSKML
SQIAWLCSRIEVDGMRADLVITRTALAHAAWQGRTQITDEDVEVAARLALPHRRRRNPFD
APEMEERKLQEVLQEARNFYKDTTKQGPAAEETDEETGATALIDTENPTDEQGLEGTAQA
KAQTTGKVGTAGHGEPFRS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgccggttacccgaaaggccagcgattaccccatgtccaccaatcaggtgctccgatac
ccgttctccgcagtggtggggcaggatgaactccgcctcgcgctgattctcaccgccatc
tcaccccgcatcggtggcgtggtggtccgtggcgagaagggaacagccaagaccaccacc
gtccgtgcctttgccgggctgcttggtgatgcgccactgatcaacctcccacttggtgcc
accgaggaccgcgttgtcggttccctcaacatggagaccgtcctgaccaccggccgcgcc
gagtacaagccgggtctgttggcccaggcggacggtggtgtcctctacgtcgatgaggtc
aacctgctcgcggaccacctcgtcgatgcgcttctcgacgccgccgccagcggtcgcgtc
tctatcgagcgcgatggcatctcccattcctcacccgcgaacttcgtgctggtgggcacc
atgaacccggaggagggcgaactgcgcccccagctgcttgaccgtttcggcctggccgtg
gacgtggtggcctccaacaaccccgagatccgcgtggagatcatccagcggcgtctggcc
tatgaggccaatcccgagcagttcgtgcaggactgggccgcgcaggatgaggagatctcc
cagcgcatccacaccgcccgtcagctgctgcccaacgttgagctgcccagcaagatgctc
tcgcagatcgcctggctgtgctcccgcatcgaggtggacggcatgcgcgccgacctcgtg
atcacccgcaccgccctggcacatgccgcctggcagggccgcacccagatcaccgatgag
gatgtcgaggtcgccgcccgcctggcgctgccacaccgtcgtcgtcgaaaccccttcgat
gccccggagatggaggaacgcaagctgcaggaggtgctgcaggaggcgcgcaacttctac
aaggacaccaccaagcagggcccggctgccgaggagacggacgaggagaccggcgcgacc
gccctgatcgacaccgagaaccccaccgacgaacagggattagagggcactgcccaggcc
aaggcccagacgaccggaaaggtaggtactgccggacacggcgaaccctttcgctcctag

DBGET integrated database retrieval system