KEGG   Corynebacterium efficiens: CE1905Help
Entry
CE1905            CDS       T00103                                 

Definition
(GenBank) putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cef  Corynebacterium efficiens
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CE1905
Enzymes [BR:cef01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CE1905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(2016319..2017833)
Genome map
AA seq 504 aa AA seqDB search
MVYFRSCSHISPGDAKKPLWRMSLHAALSCRNGLRLPGFPRTPSLVLPQTGVPGHPPRPV
PPHRGPGSSVSIVGMSRPSPSRSPWTVHRGPYTVHHGPPGNPPNPGVDVTMVSVTTKILI
LGSTGSIGTQALEVIADNPDLFTLVGIAAGGSNPGLVIEQARAFNLRPHQVAVAGKQAAG
EVGEALGGTVIDGPDAAQTLVESVQATDPADAVLNALVGSMGLGATLATLRSGAHLALAN
KESLVAGGEFVMAQARPGQIIPVDSEHSAMAQCLRSGTEGEVARIVLTASGGPFRGWTRE
QMWEVTPEQAAAHPTWSMGQMNTLNSATLINKGLELIEATLLFDTDADLIDVTVHPQSII
HSMITFRDGCTIAQASPPSMKLPIALAMNWPHRVPGAQPALDFTQAHTWTFEPVDDAAFP
AVQLARDVAKQKGTFPAVYNAANEEAAAAFLAGRIRFPQIVDVVSEILQGASQFAGVSSD
VDDILATESEARARANQLIDRLAR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
ttggtttacttccgttcatgttctcacatttcccctggcgacgctaaaaaacccctgtgg
cgtatgtcgctccatgctgctctgagctgcaggaacgggcttcgcctgccgggttttccc
agaaccccatccttagtattgccccaaacgggtgtacccgggcacccgccgcgaccagtt
ccacctcaccgggggcctggatcgtcggtaagcatcgtcggaatgtcccgcccctcaccg
tcccgatcaccgtggacggtacaccgtggaccgtacaccgtgcatcatggtccacccggg
aatccgccaaaccccggggtggatgtaacaatggtgtccgtgactacaaagattctcatc
ctcggcagcaccggttcgattggaacccaggcgttggaggtcatcgctgacaaccccgat
ctgttcaccctcgtgggcatcgccgcgggcgggtccaatcccggcctggtcattgagcag
gcccgggcattcaacctccggccgcatcaggtggcggtggcggggaagcaggcggccggc
gaggtgggggaggctctcggcggcaccgtcatcgacggccccgatgctgcacagacactg
gtggaatcggtccaggccaccgacccggccgatgcggtcctcaatgccctggtcggttcc
atggggctgggtgccacactcgcgacgctgcgttccggtgcccacctggcgctggccaac
aaggaatcgctggtggccggcggtgagttcgtgatggcccaggcacgacccgggcagatc
atccccgttgactccgagcactccgccatggctcagtgcctgcgcagcgggaccgagggg
gaggtcgcgcgcatcgtgctgaccgcctccggtggcccattccgcggctggactcgggag
cagatgtgggaggtcacgccggagcaggcggccgcccacccgacctggtccatggggcag
atgaacaccctcaattccgccaccctgatcaacaagggcctggaactgatcgaggcgacc
ctgctctttgacaccgatgccgacctcatcgatgtcacggtgcatccccagtcgatcatc
cactcgatgatcaccttcagggatggctgcaccatcgctcaggcatccccgccgtcgatg
aagctgccgatcgcgctggccatgaactggccgcaccgcgtaccgggtgcgcagccagcc
cttgatttcacgcaggcccacacctggaccttcgagcctgtcgacgacgccgcgttcccg
gccgtgcagttggcacgcgacgtcgcaaagcagaagggcaccttccccgcggtgtacaac
gccgccaacgaggaggccgccgcggccttcctcgccgggcgcatccgtttcccacagatc
gttgatgtggtgtcggaaatactccagggggcttcccagtttgctggtgtatcctcagat
gtcgatgacattctggccaccgagtccgaggcccgtgcgcgcgcgaatcagctcattgac
cggctggcccgttag

DBGET integrated database retrieval system