KEGG   Corynebacterium efficiens: CE1975Help
Entry
CE1975            CDS       T00103                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cef  Corynebacterium efficiens
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:cef03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2086475..2087332)
Genome map
AA seq 285 aa AA seqDB search
MPELPEVEVVRRGLEEHMVGRTIVSAAVVHPRTARNQAGGGAEIEANLTGLRVGATNRRG
KFLWLELDDVAQQAPSGLGLLVHLGMSGQMLVKSPDATLNPHLRARAELDDGNEVWFVDQ
RTFGYWWLGELVDGVPGRVSHIARDLLDDALDIPALAAVLKTKNTEIKRLLLNQEIVSGI
GNIYADEMLWEAGIHPRQKASRISLTRLVALLEAGREVMTRALDQGGTSFDALYVNVNGA
SGYFSLSLNAYGQAGKPCARCGTPIARETFMNRGSHFCNRCQKVR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgaactaccggaagttgaggtggtccgccgcggtctggaggagcacatggtggga
cgcaccatcgtctccgccgcggtggtgcatccgcgtacagcccgcaaccaggccggcggg
ggcgccgagatcgaggccaatctcaccggcctgagggtcggtgccaccaaccggcgcggg
aaattcctgtggctggaactcgatgatgttgcgcagcaggcaccctccggtctggggctg
ctcgtccatctgggtatgagtgggcagatgctggtcaagtcccccgacgcaaccctcaac
ccgcatctgcgggcacgggcggagcttgacgacggcaacgaggtctggttcgtcgaccag
cgcaccttcgggtactggtggctgggggagcttgtcgacggggtccccggacgtgtctct
cacatcgcccgtgatctcctcgatgacgcccttgacatcccggcgctcgccgcggtgctc
aagacgaagaacaccgagatcaaacgtctcctgctcaatcaggagatcgtctccggcatc
ggcaacatctacgccgatgagatgttgtgggaggcgggtatccacccccggcagaaggcc
agcaggatctccctcacccgtctggtggcgctgctggaggccgggcgtgaggtcatgacc
cgcgccctggaccagggcgggaccagcttcgatgcgctctacgtcaatgtgaatggcgcg
tccgggtacttctcactctcgctcaatgcctatgggcaggcgggtaaaccgtgtgcgcgg
tgtgggaccccgatcgcccgggagaccttcatgaaccggggcagccacttctgcaatcgt
tgtcagaaagtgcgctga

DBGET integrated database retrieval system