KEGG   Corynebacterium efficiens: CE1991Help
Entry
CE1991            CDS       T00103                                 

Definition
(GenBank) putative indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cef  Corynebacterium efficiens
Pathway
cef00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cef01100  Metabolic pathways
cef01110  Biosynthesis of secondary metabolites
cef01130  Biosynthesis of antibiotics
cef01230  Biosynthesis of amino acids
Module
cef_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CE1991
Enzymes [BR:cef01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CE1991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PdxJ ThiG QRPTase_C NanE
Motif
Other DBs
NCBI-ProteinID: BAC18801
NITE: CE1991
UniProt: Q8FP02
Position
complement(2105821..2106606)
Genome map
AA seq 261 aa AA seqDB search
MVTVENRILQDVAAEVATREARVTFQDVKDQSRSPGLPAALDVRSVFLGSGCNLVAGFDR
FASDWSDHKDPVDFATRLEECGAAALSYMVRRGRFEIAAQDIRDIKAAVNLPLLLDDLIV
DPYQIHEARVLGADALALAVWTMDPHKLAALLDRTESLGMTALVEVRNPAEAARAAEVGA
SVVAIDITGYQGPKTLPEAFAGVCSQLPQETARIVLGGCWTPKELMAFARQSADAIYVPH
TPLASTRSLISAGMHPACPSR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggtaacggtggaaaaccgtattctccaggatgttgcagccgaggtcgcgacacgggaa
gcacgggtgacgttccaggacgtcaaggatcagtcacgttcacccggtctgccggcggcg
cttgatgtccgttcggtattcctgggttccggttgcaacctggtggccggattcgatcgt
ttcgcatcagactggtcggatcacaaggaccccgttgatttcgccacccgcctggaggag
tgtggggccgccgcgctcagctatatggtccgcaggggacggttcgagatcgcggcgcag
gacatcagggatatcaaggctgctgtcaatctcccgctgcttctcgatgatctcatcgtc
gacccctatcagatccatgaggcccgcgtcctcggtgcggatgccctggcgctggcggtc
tggaccatggatccgcacaaactggccgccctgctcgaccgcacggaatccctgggtatg
accgcgctggtggaggtgcgcaacccggcggaggccgcccgcgccgctgaggtgggggct
tccgtggtggccatcgatatcaccggttaccaggggccgaaaacactcccggaggccttc
gccggggtctgttcccagctcccgcaggaaaccgcccgcatcgtcctcggcgggtgttgg
acaccgaaggaactcatggccttcgcccggcagtccgccgatgctatctacgtgccccac
acccccctcgcctcaacccggtcgctgatctcggcaggcatgcatccggcctgcccatcg
cggtag

DBGET integrated database retrieval system