KEGG   Corynebacterium efficiens: CE2078Help
Entry
CE2078            CDS       T00103                                 

Gene name
glk
Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cef  Corynebacterium efficiens
Pathway
cef00010  Glycolysis / Gluconeogenesis
cef00052  Galactose metabolism
cef00500  Starch and sucrose metabolism
cef00520  Amino sugar and nucleotide sugar metabolism
cef00521  Streptomycin biosynthesis
cef01100  Metabolic pathways
cef01110  Biosynthesis of secondary metabolites
cef01120  Microbial metabolism in diverse environments
cef01130  Biosynthesis of antibiotics
cef01200  Carbon metabolism
Module
cef_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CE2078 (glk)
   00052 Galactose metabolism
    CE2078 (glk)
   00500 Starch and sucrose metabolism
    CE2078 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CE2078 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CE2078 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CE2078 (glk)
Enzymes [BR:cef01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CE2078 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK TCR DUF5353 FGGY_N
Motif
Other DBs
NCBI-ProteinID: BAC18888
NITE: CE2078
UniProt: Q8FNR6
Position
complement(2204841..2205809)
Genome map
AA seq 322 aa AA seqDB search
MSQDPDRFAVGFDIGGTNMRAGLISPSGEIIRQLSAPTPTTAGELDSGIVELVRALGETH
PIDAVGMAVAGFLDPACETVRFAPHLPWRDAPVRAHLQELLGVPVRLEHDANSAAWGEYR
FGGAQGVDNWVLLAIGTGIGAALIADGEIYRGAHGTAPEFGHLRVVPDGRPCPCGKSGCL
ERYCSGTALVDSALELSTRGGFGDSALLEVIRRDPTGLKGDMITRAARERDPLGIAVMEE
FSTWLGECLSMVADVLDPELIVIGGGVSRDTDIYLETAVAHFAGRIVGAGYRPLARVGTA
QLGADAGMIGVADLARQAVAAP
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagaccctgaccgtttcgcggtcggtttcgacattggcggaaccaacatgcgt
gctggtctgatctccccgtccggtgagatcatccgccagttgtccgcgcccacccccacg
accgccggggaactggactccgggatcgtggagctggtgcgtgccctgggggagacccat
cccattgatgcggtcggtatggccgtggcgggtttcctcgacccggcctgtgagactgtc
cgcttcgccccccacctgccgtggcgggatgcgcccgtgcgtgcccacctgcaggagctg
ctgggtgtgccggtccgcctggagcacgatgccaactccgctgcgtggggcgaataccgc
ttcggtggtgcccagggggtggacaactgggtgctgctcgctatcggcaccgggatcggg
gcggcgctgatcgccgacggggagatctaccgtggtgcccacggcaccgcaccggagttc
ggtcatctccgcgttgtaccggatgggcggccctgcccctgcggtaagtccgggtgtctg
gaacgctactgttccggtactgcactggtggattccgccctggagttgtccacccgcggc
gggttcggtgacagcgcactgttggaggtgatccgccgtgacccgacggggctcaagggt
gacatgatcacccgggcggcccgtgagcgcgatccgctcggtatcgccgtgatggaggag
ttcagcacctggttgggggagtgcctgtccatggtggctgatgtgctggatccggaactc
atcgtcatcgggggtggtgtgtcccgggataccgacatctatctcgagaccgccgtcgca
catttcgccggccgcatcgtcggggccggttaccgtcccctcgcgcgcgtcggcactgcc
cagctgggggcggatgccgggatgatcggggtcgcagacctcgcccgccaggcggtcgcg
gcaccctga

DBGET integrated database retrieval system