KEGG   Corynebacterium efficiens: CE2078Help
Entry
CE2078            CDS       T00103                                 

Gene name
glk
Definition
glucose kinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cef  Corynebacterium efficiens
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CE2078 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CE2078 (glk)
   00052 Galactose metabolism
    CE2078 (glk)
   00500 Starch and sucrose metabolism
    CE2078 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CE2078 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CE2078 (glk)
   00524 Butirosin and neomycin biosynthesis
    CE2078 (glk)
Enzymes [BR:cef01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CE2078 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2204841..2205809)
Genome map
AA seq 322 aa AA seqDB search
MSQDPDRFAVGFDIGGTNMRAGLISPSGEIIRQLSAPTPTTAGELDSGIVELVRALGETH
PIDAVGMAVAGFLDPACETVRFAPHLPWRDAPVRAHLQELLGVPVRLEHDANSAAWGEYR
FGGAQGVDNWVLLAIGTGIGAALIADGEIYRGAHGTAPEFGHLRVVPDGRPCPCGKSGCL
ERYCSGTALVDSALELSTRGGFGDSALLEVIRRDPTGLKGDMITRAARERDPLGIAVMEE
FSTWLGECLSMVADVLDPELIVIGGGVSRDTDIYLETAVAHFAGRIVGAGYRPLARVGTA
QLGADAGMIGVADLARQAVAAP
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagaccctgaccgtttcgcggtcggtttcgacattggcggaaccaacatgcgt
gctggtctgatctccccgtccggtgagatcatccgccagttgtccgcgcccacccccacg
accgccggggaactggactccgggatcgtggagctggtgcgtgccctgggggagacccat
cccattgatgcggtcggtatggccgtggcgggtttcctcgacccggcctgtgagactgtc
cgcttcgccccccacctgccgtggcgggatgcgcccgtgcgtgcccacctgcaggagctg
ctgggtgtgccggtccgcctggagcacgatgccaactccgctgcgtggggcgaataccgc
ttcggtggtgcccagggggtggacaactgggtgctgctcgctatcggcaccgggatcggg
gcggcgctgatcgccgacggggagatctaccgtggtgcccacggcaccgcaccggagttc
ggtcatctccgcgttgtaccggatgggcggccctgcccctgcggtaagtccgggtgtctg
gaacgctactgttccggtactgcactggtggattccgccctggagttgtccacccgcggc
gggttcggtgacagcgcactgttggaggtgatccgccgtgacccgacggggctcaagggt
gacatgatcacccgggcggcccgtgagcgcgatccgctcggtatcgccgtgatggaggag
ttcagcacctggttgggggagtgcctgtccatggtggctgatgtgctggatccggaactc
atcgtcatcgggggtggtgtgtcccgggataccgacatctatctcgagaccgccgtcgca
catttcgccggccgcatcgtcggggccggttaccgtcccctcgcgcgcgtcggcactgcc
cagctgggggcggatgccgggatgatcggggtcgcagacctcgcccgccaggcggtcgcg
gcaccctga

DBGET integrated database retrieval system