KEGG   Corynebacterium efficiens: CE2098Help
Entry
CE2098            CDS       T00103                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cef  Corynebacterium efficiens
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CE2098
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CE2098
  Amino acid metabolism
   00310 Lysine degradation
    CE2098
Enzymes [BR:cef01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CE2098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2228195..2229898
Genome map
AA seq 567 aa AA seqDB search
MAFSVEMPELGESVTEGTITQWLKAVGDTVEVDEPLLEVSTDKVDTEIPSPVAGVILEIK
AEEDDTVDVGGIIAIIGEEGEEGAESTEAPAEQEEAPAEEAPKEEPKKQAPASSGAATDV
EMPELGESVTEGTITQWLKAVGDTIEVDEPLLEVSTDKVDTEIPSPVAGTIVEILAEEDD
TVDVGAVIARIGDANAAPAEDAPAEEEAPAQNEAPVEETPDVTKDEAKKVEQDEPKAEKA
EKKSEPKAAPQKTNTDNVPYVTPLVRKLAEKHGVDLNSVKGTGIGGRIRKQDVLAAASGE
SAPAEKEAASAAPASAASTKSVDPEKAKLRGTTQKVNRIREITARKTVEALQISAQLTQL
HEVDMTRVAELRKSNKPAFQEKHGVNLTYLPFFVKAVVEALVAHPNVNASYNAETKEMTY
HASVNMSIAVDTPAGLLTPVIHNAQDLSLPEIAKAIVDLADRARNNKLKPNDLSGGTFTI
TNIGSEGALSDTPILIPPQAGILGTGAIVKRPVVITEDGIDSIAIRQMVHLPLTYDHQVV
DGADAGRFMTTIKDRLETANFEGDLEL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctccgtagagatgcccgagctgggcgaatcagtaaccgaaggcacgattacc
cagtggctgaaggccgtgggcgacactgtcgaggttgacgagccactgctcgaggtctcc
accgacaaggtcgacaccgagatcccctccccggtggccggcgtgatccttgagattaag
gcagaagaggatgacaccgttgatgtcggtggaatcatcgccatcatcggcgaggagggt
gaggagggcgcagagagcaccgaggcacctgctgagcaggaggaggctcctgccgaggaa
gcacccaaggaggagccgaagaagcaggcacctgcctcctccggcgccgccaccgatgtg
gaaatgccggaactcggcgaatccgtcaccgaaggcaccatcacccagtggctgaaggcc
gtcggcgacaccatcgaggtcgacgagccactgctggaggtctccaccgacaaggtcgac
accgagatcccctccccggtcgccggcaccatcgttgagatcctcgccgaggaagacgac
accgtcgacgtcggagcagtcatcgcccgcatcggcgacgccaacgcagcacccgccgag
gacgcacccgccgaggaggaagccccggcgcagaacgaggctccggtggaggaaactccc
gacgtgaccaaggacgaagccaagaaggtcgagcaggacgagccgaaggcggagaaggct
gagaagaagtctgagccgaaggccgccccgcagaagaccaacaccgacaacgtcccgtac
gtcaccccgctggtgcgcaagctggctgagaagcacggcgtggacctcaactcggtgaag
ggcaccggtatcggtggtcgcatccgtaagcaggatgtcctggctgccgcatccggtgag
tccgcaccagccgagaaggaggcagcatctgcagcccccgcctccgccgcatccaccaag
tccgtggatccggagaaggccaagctgcgtggcaccacccagaaggtcaaccgcatccgt
gagatcaccgcacgcaagaccgttgaggccctgcagatctccgctcagctgacccagctg
cacgaggtcgacatgacccgtgtcgctgaactgcgtaagagcaacaagccagccttccag
gagaagcacggtgtcaacctcacctacctgccgttcttcgtcaaggctgtggttgaggca
ctcgtcgcccacccgaacgtcaacgcgtcctacaacgccgagaccaaggagatgacctac
cacgcctccgtgaacatgtccatcgcggtggataccccagctggtctgctcaccccggtc
atccacaatgcgcaggatctgtccctgccggagatcgccaaggcgatcgtggatctggct
gatcgtgcacgcaacaacaagctgaagccgaacgatctgtcgggtggcaccttcaccatc
accaacatcggttccgagggtgcactgtccgacaccccgatcctgattccgccgcaggcc
ggaatcctgggcaccggtgctatcgtcaagcgcccggtggtcatcaccgaggacggcatc
gattcgatcgccatccgtcagatggtccacctgccactgacctacgaccaccaggtcgtg
gacggtgccgatgccggtcgcttcatgaccaccatcaaggaccgcctggagaccgccaac
ttcgaaggcgatctggagctctaa

DBGET integrated database retrieval system