KEGG   Corynebacterium efficiens: CE2098Help
Entry
CE2098            CDS       T00103                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cef  Corynebacterium efficiens
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CE2098
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CE2098
  Amino acid metabolism
   00310 Lysine degradation
    CE2098
Enzymes [BR:cef01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CE2098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2228195..2229898
Genome map
AA seq 567 aa AA seqDB search
MAFSVEMPELGESVTEGTITQWLKAVGDTVEVDEPLLEVSTDKVDTEIPSPVAGVILEIK
AEEDDTVDVGGIIAIIGEEGEEGAESTEAPAEQEEAPAEEAPKEEPKKQAPASSGAATDV
EMPELGESVTEGTITQWLKAVGDTIEVDEPLLEVSTDKVDTEIPSPVAGTIVEILAEEDD
TVDVGAVIARIGDANAAPAEDAPAEEEAPAQNEAPVEETPDVTKDEAKKVEQDEPKAEKA
EKKSEPKAAPQKTNTDNVPYVTPLVRKLAEKHGVDLNSVKGTGIGGRIRKQDVLAAASGE
SAPAEKEAASAAPASAASTKSVDPEKAKLRGTTQKVNRIREITARKTVEALQISAQLTQL
HEVDMTRVAELRKSNKPAFQEKHGVNLTYLPFFVKAVVEALVAHPNVNASYNAETKEMTY
HASVNMSIAVDTPAGLLTPVIHNAQDLSLPEIAKAIVDLADRARNNKLKPNDLSGGTFTI
TNIGSEGALSDTPILIPPQAGILGTGAIVKRPVVITEDGIDSIAIRQMVHLPLTYDHQVV
DGADAGRFMTTIKDRLETANFEGDLEL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctccgtagagatgcccgagctgggcgaatcagtaaccgaaggcacgattacc
cagtggctgaaggccgtgggcgacactgtcgaggttgacgagccactgctcgaggtctcc
accgacaaggtcgacaccgagatcccctccccggtggccggcgtgatccttgagattaag
gcagaagaggatgacaccgttgatgtcggtggaatcatcgccatcatcggcgaggagggt
gaggagggcgcagagagcaccgaggcacctgctgagcaggaggaggctcctgccgaggaa
gcacccaaggaggagccgaagaagcaggcacctgcctcctccggcgccgccaccgatgtg
gaaatgccggaactcggcgaatccgtcaccgaaggcaccatcacccagtggctgaaggcc
gtcggcgacaccatcgaggtcgacgagccactgctggaggtctccaccgacaaggtcgac
accgagatcccctccccggtcgccggcaccatcgttgagatcctcgccgaggaagacgac
accgtcgacgtcggagcagtcatcgcccgcatcggcgacgccaacgcagcacccgccgag
gacgcacccgccgaggaggaagccccggcgcagaacgaggctccggtggaggaaactccc
gacgtgaccaaggacgaagccaagaaggtcgagcaggacgagccgaaggcggagaaggct
gagaagaagtctgagccgaaggccgccccgcagaagaccaacaccgacaacgtcccgtac
gtcaccccgctggtgcgcaagctggctgagaagcacggcgtggacctcaactcggtgaag
ggcaccggtatcggtggtcgcatccgtaagcaggatgtcctggctgccgcatccggtgag
tccgcaccagccgagaaggaggcagcatctgcagcccccgcctccgccgcatccaccaag
tccgtggatccggagaaggccaagctgcgtggcaccacccagaaggtcaaccgcatccgt
gagatcaccgcacgcaagaccgttgaggccctgcagatctccgctcagctgacccagctg
cacgaggtcgacatgacccgtgtcgctgaactgcgtaagagcaacaagccagccttccag
gagaagcacggtgtcaacctcacctacctgccgttcttcgtcaaggctgtggttgaggca
ctcgtcgcccacccgaacgtcaacgcgtcctacaacgccgagaccaaggagatgacctac
cacgcctccgtgaacatgtccatcgcggtggataccccagctggtctgctcaccccggtc
atccacaatgcgcaggatctgtccctgccggagatcgccaaggcgatcgtggatctggct
gatcgtgcacgcaacaacaagctgaagccgaacgatctgtcgggtggcaccttcaccatc
accaacatcggttccgagggtgcactgtccgacaccccgatcctgattccgccgcaggcc
ggaatcctgggcaccggtgctatcgtcaagcgcccggtggtcatcaccgaggacggcatc
gattcgatcgccatccgtcagatggtccacctgccactgacctacgaccaccaggtcgtg
gacggtgccgatgccggtcgcttcatgaccaccatcaaggaccgcctggagaccgccaac
ttcgaaggcgatctggagctctaa

DBGET integrated database retrieval system