KEGG   Corynebacterium efficiens: CE2122Help
Entry
CE2122            CDS       T00103                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cef  Corynebacterium efficiens
Pathway
cef00260  Glycine, serine and threonine metabolism
cef00750  Vitamin B6 metabolism
cef01100  Metabolic pathways
cef01110  Biosynthesis of secondary metabolites
cef01120  Microbial metabolism in diverse environments
cef01230  Biosynthesis of amino acids
Module
cef_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CE2122 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CE2122 (thrC)
Enzymes [BR:cef01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CE2122 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP sCache_3_2
Motif
Other DBs
NCBI-ProteinID: BAC18932
NITE: CE2122
UniProt: Q8FNM2
Position
complement(2251667..2253190)
Genome map
AA seq 507 aa AA seqDB search
MSKSRHPENDGHPGESYPTPWANLYCVDYISTRDSSRTPARFSDILLGGLAPDGGLYLPV
EYPQITDDTLTEWRGILATDGYAALAAEVIALFADDIPAEDIRAMTARAYTHPKFSSEEI
VPVTELEDGLWIGHLSEGPTAAFKDMAMQLLGELFEYELRRRGETLNILGATSGDTGSAA
EYAMRGREGIRVFMLTPAGRMTPFQQAQMFGLDDPNIFNIALDGVFDDCQDVVKAVSADA
EFKREQRIGAVNSINWARLMAQVVYYISSWIKVTDSNDQKVSFSVPTGNFGDICAGHIAR
QMGLPIDRLIVATNENDVLDEFFRTGEYRVRSSEDTHETSSPSMDISRASNFERFVFDLL
GRDAARVNDLFGTQVKQGGFSLADDPVFLEAADRYGFASGRSTHANRVETIRDIATRLDV
VIDPHTADGVYVARQWRDEVTTPIICLETALPVKFADIIREATGAEPEMPERFAAIMDAE
HKVSDLPNDAEVVKQFIVDSIANTSVK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaagtcacggcatcccgaaaatgatgggcatccgggggagtcttatcccaccccc
tgggctaatctgtattgcgtggactacatttcgacgcgtgattccagccgcacccctgcc
cgattcagcgatatcctgctcggtggcctcgccccggacggtggactctacctgccggtg
gagtatccccagatcaccgatgacaccctgaccgagtggcgtggcatcctcgccactgac
ggttatgcagccctggccgccgaggtcatcgccctgttcgccgatgacatcccggccgag
gacatccgcgccatgaccgcgcgcgcctacacccatcccaagttctcctccgaggagatc
gttcccgtgacggagctggaggatgggttgtggatcggccacctctccgaggggcccact
gctgcattcaaggatatggccatgcagctgctgggtgagctgtttgagtacgagctgcgc
cgccgcggcgagaccctcaacatcctcggtgccacctcgggtgacaccggttccgccgcc
gaatacgccatgcgtggccgtgagggtatccgtgtcttcatgctcaccccggccggtcgc
atgaccccgttccagcaggcccagatgttcggtctggatgaccccaacatcttcaacatc
gccctggacggtgtcttcgatgactgccaggatgtggtcaaggcggtctccgcggatgcg
gagttcaagcgggaacagcgtatcggtgcggtcaactccatcaactgggcgcgtctcatg
gcccaggtggtgtactacatctcctcctggatcaaggtgaccgacagcaacgaccagaag
gtcagcttctcggttcccaccggtaacttcggtgatatctgcgccggtcacatcgcccgt
cagatggggctgccgatcgaccgcctgatcgtggccaccaacgaaaatgatgttctggat
gagttcttccgcaccggcgagtaccgcgtgcgcagctcggaggacacccacgagacctcc
agcccgtcgatggacatctcccgcgcctccaacttcgaacgattcgtcttcgacctgctg
ggtcgcgacgcagcccgcgtgaatgatctgttcggcacccaggtcaaacagggtggtttc
tccctggccgatgatccggtgttccttgaggcggccgaccgctacgggttcgcctcgggt
cgttccacccatgccaaccgtgtggagaccatccgggatatcgcgacgcgcctcgacgtg
gtcatcgacccccacaccgcggacggtgtgtacgtcgcacgccaatggcgcgatgaggtc
accaccccgatcatctgcctggaaaccgccctgccggtgaagttcgcggacatcatccgt
gaggccaccggtgcggagccggagatgccggaacgtttcgccgccatcatggatgccgag
cacaaggtgtcggacctgcccaatgatgccgaggtggtcaagcagttcatcgtggactcg
atcgccaacaccagcgtgaagtaa

DBGET integrated database retrieval system