KEGG   Corynebacterium efficiens: CE2122Help
Entry
CE2122            CDS       T00103                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cef  Corynebacterium efficiens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CE2122 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CE2122 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CE2122 (thrC)
Enzymes [BR:cef01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CE2122 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2251667..2253112)
Genome map
AA seq 481 aa AA seqDB search
MDYISTRDSSRTPARFSDILLGGLAPDGGLYLPVEYPQITDDTLTEWRGILATDGYAALA
AEVIALFADDIPAEDIRAMTARAYTHPKFSSEEIVPVTELEDGLWIGHLSEGPTAAFKDM
AMQLLGELFEYELRRRGETLNILGATSGDTGSAAEYAMRGREGIRVFMLTPAGRMTPFQQ
AQMFGLDDPNIFNIALDGVFDDCQDVVKAVSADAEFKREQRIGAVNSINWARLMAQVVYY
ISSWIKVTDSNDQKVSFSVPTGNFGDICAGHIARQMGLPIDRLIVATNENDVLDEFFRTG
EYRVRSSEDTHETSSPSMDISRASNFERFVFDLLGRDAARVNDLFGTQVKQGGFSLADDP
VFLEAADRYGFASGRSTHANRVETIRDIATRLDVVIDPHTADGVYVARQWRDEVTTPIIC
LETALPVKFADIIREATGAEPEMPERFAAIMDAEHKVSDLPNDAEVVKQFIVDSIANTSV
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
gtggactacatttcgacgcgtgattccagccgcacccctgcccgattcagcgatatcctg
ctcggtggcctcgccccggacggtggactctacctgccggtggagtatccccagatcacc
gatgacaccctgaccgagtggcgtggcatcctcgccactgacggttatgcagccctggcc
gccgaggtcatcgccctgttcgccgatgacatcccggccgaggacatccgcgccatgacc
gcgcgcgcctacacccatcccaagttctcctccgaggagatcgttcccgtgacggagctg
gaggatgggttgtggatcggccacctctccgaggggcccactgctgcattcaaggatatg
gccatgcagctgctgggtgagctgtttgagtacgagctgcgccgccgcggcgagaccctc
aacatcctcggtgccacctcgggtgacaccggttccgccgccgaatacgccatgcgtggc
cgtgagggtatccgtgtcttcatgctcaccccggccggtcgcatgaccccgttccagcag
gcccagatgttcggtctggatgaccccaacatcttcaacatcgccctggacggtgtcttc
gatgactgccaggatgtggtcaaggcggtctccgcggatgcggagttcaagcgggaacag
cgtatcggtgcggtcaactccatcaactgggcgcgtctcatggcccaggtggtgtactac
atctcctcctggatcaaggtgaccgacagcaacgaccagaaggtcagcttctcggttccc
accggtaacttcggtgatatctgcgccggtcacatcgcccgtcagatggggctgccgatc
gaccgcctgatcgtggccaccaacgaaaatgatgttctggatgagttcttccgcaccggc
gagtaccgcgtgcgcagctcggaggacacccacgagacctccagcccgtcgatggacatc
tcccgcgcctccaacttcgaacgattcgtcttcgacctgctgggtcgcgacgcagcccgc
gtgaatgatctgttcggcacccaggtcaaacagggtggtttctccctggccgatgatccg
gtgttccttgaggcggccgaccgctacgggttcgcctcgggtcgttccacccatgccaac
cgtgtggagaccatccgggatatcgcgacgcgcctcgacgtggtcatcgacccccacacc
gcggacggtgtgtacgtcgcacgccaatggcgcgatgaggtcaccaccccgatcatctgc
ctggaaaccgccctgccggtgaagttcgcggacatcatccgtgaggccaccggtgcggag
ccggagatgccggaacgtttcgccgccatcatggatgccgagcacaaggtgtcggacctg
cccaatgatgccgaggtggtcaagcagttcatcgtggactcgatcgccaacaccagcgtg
aagtaa

DBGET integrated database retrieval system