KEGG   Corynebacterium efficiens: CE2165Help
Entry
CE2165            CDS       T00103                                 

Definition
secreted alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cef  Corynebacterium efficiens
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cef00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cef00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:cef02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2297302..2298990
Genome map
AA seq 562 aa AA seqDB search
MPFGQRTHYTHDIFPQYANPRFVSHYHEEPIPSRAEELTMQAATITRRLFLRGTALAATV
ATIGGTKTAHATAPHQWFQHGVASGDPTPSSVILWTRVTPTPEATPGSGVGEPVGVAWEV
AREASISTVVARGTAVTGPECDHTIHVDPGGLEPATHYYYRFTAPDGERSPVGTTTTLSL
IDAPLSSLNLAVASCANWEAGHFAAYRDIARRADAGELDLVVFLGDYIYEYARGTFVGGS
GMVRATEPAEETVRLDQYRTRYGLHRTDPHLQAAHAALPWIVMWDDHETANDSWRDGAQN
HQPHEGPWHDRKQAALQAYLEWLPIRAGADDPLYRSFTFGTLGHLSMLDLRSFRDAPPTH
QQWLGGMRGTTMMGTAQFDWLKTQIEHSTARWNIIGSSVMFSPMQVTGGPHIQLPDPLPA
NLDQWDGYSLERDRLLTVLADTGRPALFLAGDIHSEWGSTLRHGDRHVGVELVGSSITSA
NVNDFLGLPEDNPVSLSSEGFIRTNAPHVRHVDLDAHGYAIASLGPESVQLRWLRVADIT
RPDSPVAPAVSLDWVYGTGFTS
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
ttgcctttcggacaacggactcattatacccatgacattttcccccaatatgccaacccc
cggttcgtgtcgcattatcatgaggaaccaatcccctcccgcgccgaggagctcaccatg
caggcagcaaccatcacccgtcgccttttcctccggggcaccgcccttgccgcgacggtg
gccaccataggtgggacaaagacagcacacgccacagctccccaccaatggtttcaacac
ggggtggcctccggggaccccacgcccagctctgtgatcctgtggacacgcgtcaccccc
acaccggaggcaaccccgggcagcggggtgggtgagccggtcggggtggcgtgggaggtg
gcgagggaggcgtcgataagcaccgtcgtggcgcgcggcaccgcggtgacggggccggaa
tgcgaccacaccatccacgtcgacccgggcgggctggagcccgcgacccactactactac
cggttcaccgccccggacggcgagcggtccccggtggggaccaccacgacgctttcgctt
atcgacgcccccctgtcctccctcaacctcgccgtggcctcgtgcgccaactgggaagcc
ggccacttcgcggcctatcgtgacatcgcccggcgcgccgacgcaggtgaactggacctg
gtggtgttcctgggtgactacatctacgaatacgcacgcggcaccttcgtcggcggatcc
gggatggtgcgtgccaccgaacccgccgaggagaccgtccgtctcgatcagtaccgcaca
cgctatggcctgcaccgcacggacccccacctgcaggccgcccatgccgcactgccgtgg
atcgtgatgtgggatgaccacgaaaccgccaatgactcctggcgtgacggtgcgcagaac
caccaaccccatgaaggcccctggcacgatcggaaacaagccgcactgcaggcgtacctg
gaatggctaccgatccgcgcgggcgccgacgaccccctctaccgctccttcaccttcggc
accctggggcacctgtccatgctggatctgcgcagtttccgcgacgcaccacccacccac
cagcagtggctgggcgggatgcgtgggaccaccatgatggggaccgcacagtttgactgg
ttgaaaacccagatcgaacacagcaccgcccggtggaacatcatcggcagctccgtcatg
ttctcccccatgcaggtcaccggcggcccccacatccagctgccggatcccctgcctgcc
aacctcgatcagtgggacgggtactccctggaacgcgaccgcctgctcaccgtcctcgcc
gacaccggtcgccccgcactcttcctggccggtgacatccactccgagtggggcagcacc
ctgcgtcacggtgaccggcacgtcggggtggaactggtcggcagttccatcacctccgcc
aatgtcaacgatttcctgggactgcccgaggacaatcccgtcagcctcagcagtgagggt
ttcatccggaccaacgccccccatgtacgccatgtggatctggatgcccatggatacgcc
atcgcctccctcgggccggaatccgtccagctgcgctggttgcgggtcgccgacatcacc
aggcctgactccccggtcgccccagcggtgtcactggactgggtttacggcaccggattt
acctcctga

DBGET integrated database retrieval system