KEGG   Corynebacterium efficiens: CE2196Help
Entry
CE2196            CDS       T00103                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cef  Corynebacterium efficiens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CE2196
Enzymes [BR:cef01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CE2196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2330263..2332389
Genome map
AA seq 708 aa AA seqDB search
MTARGPLQDLAGLYGISTSYTDYKGADIEVSDDTLIKVLRALDVDLGEGEPSDGTINAAI
ERFHDREFSRPLPPCVVAVQGDEVVFPVHVHDGAPAEVHIEFESGERREAHQVENWTPPR
EVDGTTWGEASFKLPADLPLGWHQLRLTSGEMTVTCGLTITPERLSTADKYLESPRTGVM
AQIYSVRSNLSWSMGDFNDLGHLASVLAVDGADFLLINPLHAAEPLPPTEDSPYLPTTRR
FINPIYLRVEDVPEFNQLPVELRDDVAELADEFREENFTPDIIERNPVFEAKLQVLHEIF
RVERSPGREQAFRDFVEQEGQGLVDFASWCAEREITQLASAHHAEPDRDELTTFYMWLQW
LCDEQLAAAQKRAVDSGMSIGIMADLAVGVHPGGADSQNLAHVLAPDISVGAPPDGYNQQ
GQDWSQPPWNPTRLAEEGYIPWRNLLRTVLRHSGGIRVDHVLGLFRLFVMPRMESPATGT
YLNFDHDALVGILALEAELADAVVIGEDLGTFEPWVQDVLASRGIMGTSILWFEHSPTHE
GPRRQEEYRPLALTSVTTHDLPPTAGYLAGEHIDLRDRLGVLTRDPAIEHEEDLQWQAEI
LDVVAAAGALPMPEGGTYVGLERSERGELADLLAGLERFVAGTPSALTCVSLVDMVGDKR
AQNQPGTTRDMYPNWCIPLCDNDGTPVTIEALREHPLYRVVSDAARRD
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
gtgactgcacgaggacctttacaagacctggccggcctgtacggcatctccacctcatac
acggattacaagggcgccgacattgaggtcagtgatgacacgctgatcaaggttctccgc
gcccttgatgtggatctgggtgagggtgagccgtcggatgggaccatcaacgccgccatt
gaacgtttccacgacagggagttctcccgtcccctgccaccgtgtgtggtggcggtgcag
ggtgatgaggtggtcttccccgtccatgtgcacgatggcgcgcccgccgaggtgcatatt
gagttcgaatcgggcgagcgtcgagaagcacaccaggtggagaactggacgccgccgcgc
gaggtggacggcaccacctggggtgaggcgagcttcaagctgcccgccgacctgccgctc
ggctggcaccagctgcgcctgacctccggggagatgaccgtgacctgcggattgaccatc
accccggaacgtctgtccaccgcggacaagtatctggaatccccccgcaccggtgtcatg
gcgcagatctactccgtgcgttccaatctgtcgtggagcatgggtgatttcaacgacctg
ggtcacctcgccagtgtgctggccgtcgacggtgccgatttcctcctcatcaaccccctg
catgccgcggagccactgccgcccaccgaggattcgccgtacctgcccaccacccggcgg
ttcatcaacccgatctacctccgcgtggaggatgtgccggagttcaaccagctcccggtg
gagctgcgcgacgatgtcgccgagcttgccgacgagttccgcgaggagaacttcaccccc
gacatcatcgaacgcaaccccgtcttcgaggccaagctgcaggtgctgcacgagatcttc
cgcgtcgagcgctcccccgggcgcgagcaggccttccgcgatttcgtggagcaggagggt
cagggcctggttgatttcgcgtcctggtgcgccgagcgggagatcacccagctggcctcc
gcgcaccacgccgaaccggaccgcgatgagctgaccaccttctacatgtggctgcagtgg
ctgtgcgatgagcagctggccgccgcccagaagcgcgcggtggactcaggcatgtcgatc
ggcatcatggccgacctcgccgtcggtgtgcaccccggtggtgccgattcccagaacctg
gcgcatgtgctcgcgccggacatctcggtgggcgcaccgccggacggttacaaccagcag
ggccaggactggtcccagccaccatggaatccgaccaggctcgccgaggaggggtacatc
ccgtggcgtaatctgctgcgcaccgtcctgcgccactccggtggcatccgcgtggaccac
gtcctgggtctgttccgtctgtttgtcatgccccgcatggaatcacccgccaccggcacc
tacctcaacttcgaccacgacgcgctggtgggcatcctggccctggaggccgagcttgcc
gacgccgtcgtcatcggcgaggacctgggcaccttcgagccctgggtccaggacgtgctg
gccagccgtggcatcatgggcacctccatcctgtggttcgagcattccccgacacacgag
ggtccccgtcgccaggaggagtaccgtccgctggcgctgacctcggtgaccacccatgat
ctgccgcccaccgcgggttacctcgccggcgaacacatcgacctgcgcgaccgcctcggt
gtgctcacccgcgacccggccatcgagcacgaggaggacctgcagtggcaggctgagatc
ctcgatgtggtcgccgccgccggtgccctgcccatgcccgagggtggcacctacgtgggc
ctcgaacggtccgagcgtggtgagctcgcggacctgctggccggtttggaacgcttcgtg
gccggcaccccctccgccctgacgtgcgtgtccctggtggacatggtcggtgacaagcgc
gcccagaaccagcccggcaccacccgcgacatgtaccccaactggtgcatcccgctgtgc
gacaacgacggcaccccggtcaccatcgaggcgctgcgcgagcatccgctctaccgcgtc
gtctcggatgcggccaggcgcgactag

DBGET integrated database retrieval system