KEGG   Corynebacterium efficiens: CE2230Help
Entry
CE2230            CDS       T00103                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cef  Corynebacterium efficiens
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CE2230
Enzymes [BR:cef01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CE2230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2373273..2374190
Genome map
AA seq 305 aa AA seqDB search
METTPKHGIWLGKDRADGWAQKKGENTALVYGCTYFSHSKRGRRFVSTIGTMTELITSGP
FTLSPVGAHLTSVDFDSGDVLFLSSESKFGEGNAIRGGIPLIAPWFGTLLGREPQHGWAR
TTEWEVMEGDKLSAGLVRDGLELQLSLWRTELGFEMNLGLTNKSDKTETVQLAFHPYFRV
ADVEKTTVTGAEGAQILDRVTDETSTQDGAITFDGLYDRVVLGSPEMLIDDGSRTIEVIG
RGHDATVVWNPGAEKGASFDDLGDGEWRDFVCVEPALLGEDLKGVKVEPGDSISIGMEVK
VTAKN
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccactccaaagcatgggatctggttggggaaagaccgtgctgatgggtgggca
cagaaaaaaggggaaaatactgccctggtgtatggctgcacatactttagtcattcgaaa
cgcgggaggcgattcgtgtctaccattggcactatgactgaactcatcacttccggtcca
ttcacgctgtcccccgtgggagcccacctcacctcggttgatttcgactccggggacgtg
ctgttcctcagttcggaaagcaagttcggtgagggtaacgccatccgtgggggcatcccg
ctcattgcaccgtggttcggcacactgttgggcagggaacctcaacacggttgggcgcgc
accaccgagtgggaggtcatggagggtgacaagctcagtgccggcctggtccgcgacggc
ctggaactgcagttgtcgctgtggcgcaccgaactgggttttgagatgaacctcggcctg
accaacaagtcggataagacggaaaccgtccagctcgccttccacccctacttccgcgtc
gccgatgtggagaagaccaccgtcaccggcgcggagggcgcacagatcctcgaccgggtc
accgatgagaccagcacccaggacggtgccatcaccttcgacggtctctacgaccgcgtg
gtactcggctcaccggagatgcttatcgacgatggctcccgcaccatcgaggtcatcggc
cgtgggcatgacgcgacggtggtgtggaaccccggtgcggagaagggtgcctccttcgac
gacctgggcgatggcgagtggcgtgacttcgtctgcgtcgaaccggcactgctgggtgag
gacctcaagggtgtcaaggttgaacccggtgattccatcagcatcggcatggaggtgaag
gtgacagctaaaaactaa

DBGET integrated database retrieval system