KEGG   Corynebacterium efficiens: CE2231Help
Entry
CE2231            CDS       T00103                                 

Gene name
masZ
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
cef  Corynebacterium efficiens
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CE2231 (masZ)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CE2231 (masZ)
   00630 Glyoxylate and dicarboxylate metabolism
    CE2231 (masZ)
Enzymes [BR:cef01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CE2231 (masZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2374318..2376564)
Genome map
AA seq 748 aa AA seqDB search
MPAHTRSLASKELCMNHQQIDAADKTERVTVGGMQVAKVLRDFLTESVLPRVGVDAERFW
NGFGDIVRDMTPRNRELLARRDELQAQLDEYYRENPGKPDPEKYEAFLREIGYLVDEPAP
AEIRTQNIDSEIATTAGPQLVVPILNARFALNAANARWGSLYDALYGTNAIPDEDGAERG
AEYNPVRGQKVIQWGRDFLDAVLPLDGASHADVEKYNITDGKLAAHVNDGIYRLKDRDAY
LGFTGYFEDPTSILLQNNGLHIELQIDPTHPIGKEDKTGLKDIILESAITTIMDFEDSVA
AVDAEDKTLGYRNWFLLNTGELTEEVAKGDRTFTRKLNDDRVFIGKNGAELTLHGRSLLF
VRNVGHLMTNPAILVDGEEIYEGIMDAIITTVCAIPGIAPQNKKKNSRKGSIYIVKPKQH
GPEEVAFTNELFARVEDLLDLPRHTLKVGVMDEERRTSVNLDACIMEVADRLAFINTGFL
DRTGDEIHTSMEAGAMVRKADMQTAPWKQAYEDNNVDAGIQRGLPGKAQIGKGMWAMTEL
MGEMLEKKIGQLREGANTAWVPSPTGATLHATHYHRVDVFKVQDELRAAGRRDSLGKILD
VPVAPDTNWTDAEKREELDNNCQSILGYVVRWVEQGVGCSKVPDIHDIDLMEDRATLRIS
SQILANWLRHGVVTEEQVIESLERMAVVVDEQNAGDPNYLNMAPNFTESVAFQAARDLIL
KGTESPAGYTEPILHARRREFKELHGIK
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgcacacacccgatctcttgcttcgaaggagctttgcatgaaccatcagcagatt
gacgccgctgacaagaccgaacgcgtgaccgtcggtggaatgcaggtggcgaaagtcctc
cgcgacttcctcaccgagtccgttctgccacgggtgggtgtggacgccgagcgtttctgg
aacggtttcggggacatcgtccgcgacatgaccccacgcaaccgcgaactgctcgcccgc
cgtgatgagctgcaggcccagctcgacgagtactaccgtgagaacccgggcaagcctgat
ccggagaagtacgaagccttcctccgcgagatcggctacctcgtcgatgaacccgcaccg
gctgagatccgcacccagaacatcgattccgagatcgccaccaccgccggcccccagctg
gtggtcccgatcctcaacgcccgcttcgccctcaacgccgccaacgcacgctggggttcc
ctctacgatgccctctacggcaccaacgccatcccggacgaggacggcgccgagcgtggt
gcggagtacaacccggtccgtggacagaaggtcatccagtggggccgcgacttcctcgac
gctgtcctgcccctcgatggtgcaagccacgctgatgtggagaagtacaacatcaccgac
ggcaagctggctgcccacgtcaatgacggcatctaccgtctcaaggaccgggatgcctac
ctcggattcaccggctacttcgaggaccccacctccatcctgctgcagaacaacggcctg
cacatcgaactgcagatcgacccgacccaccccatcggcaaggaggacaagaccggtctg
aaggacatcattctcgaatccgccatcaccaccatcatggacttcgaggactccgtcgcg
gctgtcgacgcggaggacaagaccctcggctaccgcaactggttcctgctcaacaccggt
gagctgactgaggaggtggccaagggcgaccgcaccttcacccgcaaactcaacgatgac
cgggtgttcatcggcaagaacggcgcagagctgaccctgcacggtcgttccctgctgttt
gtccgcaacgtcggtcacctcatgaccaaccccgcgatcctcgttgacggcgaggagatc
tacgagggcatcatggatgccatcatcaccaccgtctgcgcgatcccgggcatcgcaccg
cagaacaagaagaagaactcccgcaagggctccatctacatcgtgaagccgaagcagcac
ggtcccgaggaggtcgccttcaccaacgagctcttcgcccgcgttgaagatctgctcgac
ctgccacgccacaccctcaaggtcggtgtcatggatgaggagcgtcgcacctccgtcaac
ctggatgcctgcatcatggaggtcgccgaccgcctggcgttcatcaacaccggcttcctc
gaccgcaccggcgatgagatccacacctccatggaggccggcgccatggtccgcaaggcc
gacatgcagaccgcaccgtggaagcaggcctacgaggacaataatgtcgacgccggtatc
cagcgtggtctgcccggtaaggcacagatcggcaagggcatgtgggccatgaccgagctg
atgggggagatgctggagaagaagatcggccagctgcgcgaaggtgccaacaccgcctgg
gttccgtccccgaccggtgccaccctccacgccacccactaccaccgcgtggatgtgttc
aaggttcaggatgagctgcgtgccgccggccgccgcgactccctgggcaagatcctcgat
gtcccggtcgcacccgacaccaactggaccgacgccgagaagcgtgaggaactggataac
aactgccagtccatcctgggttatgtcgtgcgctgggtcgagcagggcgttggttgctcc
aaggtcccggacatccacgacatcgacctcatggaggaccgcgccaccctgcgcatctcc
tcccagatcctggccaactggctgcgccacggtgtggtcaccgaggagcaggtcatcgag
tccctcgagcgcatggccgtggtcgtcgatgagcagaacgccggtgacccgaactacctg
aacatggcaccgaacttcaccgagtccgttgccttccaggccgcccgcgacctgatcctc
aagggcaccgaatccccggccggctacaccgagccgatcctgcatgcccgtcgtcgcgag
ttcaaggaactccacggaatcaagtaa

DBGET integrated database retrieval system