KEGG   Corynebacterium efficiens: CE2232Help
Entry
CE2232            CDS       T00103                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
cef  Corynebacterium efficiens
Pathway
cef00630  Glyoxylate and dicarboxylate metabolism
cef01100  Metabolic pathways
cef01110  Biosynthesis of secondary metabolites
cef01120  Microbial metabolism in diverse environments
cef01200  Carbon metabolism
Module
cef_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CE2232 (aceA)
Enzymes [BR:cef01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CE2232 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: BAC19042
NITE: CE2232
UniProt: Q8RQN6
Position
2377038..2378333
Genome map
AA seq 431 aa AA seqDB search
MSNVGTPRTAQEIQQDWDTNPRWNGITRDYTAEQVAELQGSVVEEHTLAKRGAEILWDAV
SAEGDDYINALGALTGNQAVQQVRAGLKAVYLSGWQVAGDANLAGHTYPDQSLYPANSVP
NVVRRINNALLRADEIARVEGDTSVDNWLVPIVADGEAGFGGALNVYELQKGMITAGAAG
THWEDQLASEKKCGHLGGKVLIPTQQHIRTLNSARLAADVANTPTVVIARTDAEAATLIT
SDVDERDRPFITGERTAEGYYHVKPGLEPCIARAKSYAPYADMIWMETGTPDLELAKKFA
EGVRSEFPDQLLSYNCSPSFNWSAHLEADEIAKFQKELGAMGFKFQFITLAGFHSLNYGM
FDLAYGYAREGMPAFVDLQNREFKAAEERGFTAVKHQREVGAGYFDTIATTVDPNSSTTA
LKGSTEEGQFH
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgttggaacgccacgtaccgcacaggaaatccagcaggattgggacaccaac
ccacgctggaacggaatcacccgcgactacaccgctgagcaggtagctgagctccagggc
agcgtcgtcgaggagcacaccctcgcaaagcgcggcgccgagatcctgtgggatgcagtt
tccgcagagggcgacgactacatcaacgcactgggcgcccttaccggtaaccaggctgtc
cagcaggtccgtgccggcctgaaggctgtctacctctccggctggcaggtcgcaggtgac
gccaacctcgccggtcacacctaccccgaccagtccctgtacccggcgaactccgtcccg
aacgttgtccgtcgcatcaacaacgcactgctgcgcgccgatgagatcgcacgcgtcgag
ggtgacacctccgtcgacaactggctcgtcccgatcgtcgccgacggcgaggccggcttc
ggcggcgccctcaacgtctacgagctccagaagggcatgatcaccgctggtgccgcaggc
acccactgggaggatcagctcgcttccgagaagaagtgtggccacctcggtggcaaggtc
ctcatcccgacccagcagcacatccgcaccctgaactccgcccgcctggcagctgacgtg
gccaacaccccgaccgtcgtcatcgcccgcaccgacgcagaggccgccaccctgatcacc
tctgatgttgatgagcgcgaccgcccattcatcaccggcgagcgcaccgccgagggctac
taccacgtcaagccgggtctcgagccctgcatcgcacgtgcgaagtcctacgctccctac
gcagacatgatctggatggagaccggcacccctgacctcgagctggccaagaagttcgcc
gagggcgtccgcagcgagttcccggaccagctgctgtcctacaactgctccccgtccttc
aactggtctgcacacctcgaggccgacgagatcgccaagttccagaaggaactgggtgcc
atgggcttcaagttccagttcatcaccctggctggcttccactccctcaactacggtatg
ttcgacctggcatacggctacgcccgtgaaggcatgcccgccttcgtcgacctgcagaac
cgtgagttcaaggcagctgaggagcgcggcttcaccgccgtcaagcaccagcgtgaggtc
ggcgccggctacttcgacaccatcgccaccaccgttgacccgaactcctccaccaccgcg
ctgaagggttccaccgaggaaggccagttccactag

DBGET integrated database retrieval system