KEGG   Corynebacterium efficiens: CE2385Help
Entry
CE2385            CDS       T00103                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cef  Corynebacterium efficiens
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CE2385
Enzymes [BR:cef01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CE2385
    3.5.1.-  
     CE2385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2536296..2536874
Genome map
AA seq 192 aa AA seqDB search
MKGPHIMSRALILVDVQKDFCPGGTLATARGDEVAGLLGAFQLSHPQDFDAVVATQDWHI
DPGSHFSDSPDFVDSWPVHCVADSDGAAMHEKIHTDRIDEFFRKGQYSAAYSGFEGTAVS
DDTPLVDWLHARGITDVDIAGIATDHCVKATTLDALKAGFRVRVLTGFCAAVDTKTGDRA
LEEMHTAGAELL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagggccccatattatgtctcgcgcactgattctggttgatgtccagaaggatttc
tgtcccggtgggacacttgccaccgcccggggtgatgaggtcgcaggactgctcggtgcc
ttccagctctcccacccccaggactttgacgccgtggtggccacccaggattggcatatc
gatccgggcagccacttctccgacagccccgacttcgtcgattcctggcccgtccactgc
gtggccgactccgatggtgccgccatgcacgagaagatccacaccgaccgcatcgatgag
ttcttccgcaagggccagtactcggcggcctactcaggatttgagggcaccgcggtcagt
gatgacacccctctggtggactggctgcacgcccgtgggatcaccgatgtggacatcgcc
ggcatcgccaccgaccactgcgtcaaggccaccaccctcgatgccctgaaggcagggttc
cgggtgcgtgtgctcaccggtttctgcgcggcggtggatacgaaaacaggcgatcgcgcc
ctggaggagatgcacaccgccggcgcagagctgctctga

DBGET integrated database retrieval system