KEGG   Corynebacterium efficiens: CE2393Help
Entry
CE2393            CDS       T00103                                 

Definition
D-beta-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
cef  Corynebacterium efficiens
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CE2393
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    CE2393
Enzymes [BR:cef01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     CE2393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2551404..2551826)
Genome map
AA seq 140 aa AA seqDB search
MMRAAIPHMYGQGFGRIINISSVHGLRASAFKSAYVAAKHGLEGLSKVAALEGGPHGVTS
NCINPAYVRTPLVEKQIEDQAAIHGIDPDEVVEKIMLTESAVKRLVESDEVASLATWLAS
EHAGMVTGAAYTIDGGWTAS
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
ttgatgcgtgccgcgatcccccatatgtatgggcagggcttcgggcgcatcatcaatatc
tcgtcggtccatggattgcgtgccagcgcgttcaagtccgcatacgtcgccgcgaaacac
ggtctggaggggctgtccaaggtcgcggccctggagggcggcccacacggggtgacctcc
aactgcatcaacccggcctatgtgcgcacgcccctggtggagaagcagatcgaggatcag
gcagccatccacggcatcgatccggatgaggtggtggagaagatcatgctcaccgaatcc
gccgtgaaacggctggtggaatctgacgaggtcgcgtccctggccacctggctggcctcc
gagcatgctgggatggtcaccggcgccgcctacaccatcgatggcgggtggaccgcgagc
tag

DBGET integrated database retrieval system