KEGG   Corynebacterium efficiens: CE2483Help
Entry
CE2483            CDS       T00103                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cef  Corynebacterium efficiens
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CE2483
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CE2483
Enzymes [BR:cef01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CE2483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2647571..2648059)
Genome map
AA seq 162 aa AA seqDB search
MEAMTSIHDIPVTLTDGTETTMADWAGHLVMVVNVASRCGLTPQYEGLQRLFEDYQDRGF
FVIGVPCNQFMGQEPGTDAEICTFAQEKYDVTFPLLAKTDVNGENEHPLYTELKRFGEGG
DIEWNFEKFLINADGETIARFGPRMDPEDDEVTSVIEDNLPV
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtggaggccatgacttccatccatgacatccctgtaacgctcaccgacggaacggaaacc
accatggctgattgggccggtcacctcgtgatggtggtcaatgtggcctccaggtgtggc
ctgaccccacagtatgaggggctgcagcggctcttcgaggactaccaggaccgtggtttc
ttcgtgatcggggtgccctgtaaccagttcatgggccaggagcccggcaccgacgccgag
atctgtacctttgcccaggagaagtacgacgtcaccttcccattgctggccaagaccgac
gtcaacggtgaaaatgaacaccccctgtataccgagctcaaacgcttcggggagggcggc
gatatcgagtggaatttcgagaagttcctcatcaatgccgatggtgagaccattgcccgt
ttcggtccgcggatggatccggaggatgacgaggtcacctcggtgattgaggacaatctc
cccgtgtga

DBGET integrated database retrieval system