KEGG   Corynebacterium efficiens: CE2538Help
Entry
CE2538            CDS       T00103                                 

Definition
(GenBank) putative 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cef  Corynebacterium efficiens
Pathway
cef00790  Folate biosynthesis
cef01100  Metabolic pathways
Module
cef_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CE2538
Enzymes [BR:cef01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CE2538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: BAC19348
NITE: CE2538
UniProt: Q8FMG6
Position
complement(2707940..2708428)
Genome map
AA seq 162 aa AA seqDB search
MRAVLSIGSNMDDRYALLQGVIDEFRDNLVAVSSIYATPPWGVEDQDEFLNAVLVVDVDG
IPIELLRRCQKLENDADRVRTRKWGPRTLDVDIVQIRNGEQELLSDDPVLTLPHPWAWQR
AFVLIPWLEVEPNAVLHGTAVAALVENLDPTDIEGVTKVREF
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccgtactctccataggctccaacatggatgaccgttatgccctgctgcagggt
gtcatcgatgagttccgggacaacctggtcgcagtgtcctccatctacgccaccccgccg
tggggtgtggaggaccaagatgaattcctcaacgcggtgctggtggtcgatgttgacggc
atcccgattgagctgctgcgccggtgtcagaaactggagaacgacgccgaccgggtgcgc
acccgcaaatggggaccccggaccctggacgtggacatcgtccagatccgcaacggtgag
caggaactgctctccgatgaccccgtgctgaccctgccacacccgtgggcctggcagcgt
gccttcgtgctcatcccgtggctggaggtcgagcccaatgccgtcctccacggcaccgct
gtggcggcactggtggagaacctcgatccgacagacattgaaggcgtgaccaaggtcagg
gagttctaa

DBGET integrated database retrieval system