KEGG   Corynebacterium efficiens: CE2540Help
Entry
CE2540            CDS       T00103                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cef  Corynebacterium efficiens
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CE2540
Enzymes [BR:cef01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CE2540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2708808..2709662)
Genome map
AA seq 284 aa AA seqDB search
MNVADLTVPGRCLVMGIVNVTEDSFSDGGRYIETDRAIEHARRLVAEGADIIDIGGESTR
PGAVRVDAEDERNRVVPVIAALREEGIHTSVDTMRASVAAAAAEAGVSMINDVSGGLADP
DMFSVMADAAIPVCLMHWKTVQFGDAAGRADHGGNVVTDVHETLDDLVTRALAAGVAGDQ
IVLDPGLGFAKSREDNWALLNALPEFIGGEFPVLVGASRKRFLAGVRRERGLEVTPVDAD
PATAAVTAISAHMGAWGVRVHNVPVSRDAVDVAAHWRSAGDYRG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtggcagaccttactgttccggggcgttgtctggtgatgggcatcgtcaatgtc
accgaggattccttctcggacggcggtcggtacatcgagaccgaccgcgcgattgagcac
gcccgtcgtctggtggccgagggggcggacatcatcgacatcggcggggaatccacccgc
ccgggggccgtccgcgtggacgcagaggatgaacgcaaccgcgtggtgccggtgatcgcc
gcgctgcgtgaggagggcatccacacctcggtggacaccatgcgtgcctcggtggcggct
gccgctgcggaggcgggggtatccatgatcaatgatgtctccggtggtctggctgatccg
gacatgttctccgtcatggccgacgccgcgatcccggtgtgtctcatgcactggaagacc
gtgcagttcggggatgctgccggacgtgcggaccacgggggcaatgtggtcaccgatgtg
catgaaaccctcgatgacctggtcacccgcgccctggccgccggtgtggccggggatcag
atcgtcctggatccgggcctgggtttcgctaagtcacgtgaggacaactgggcgctgctc
aacgccctgcccgagttcatcggtggggagttccccgtcctggtcggcgcctcccgcaag
cgtttcctcgccggggtgcgccgcgaacgcggcctggaggtgacacctgtcgacgccgat
ccagccaccgccgcggtcaccgccatctccgcacacatgggcgcctggggcgtgcgggtg
cacaatgtgccggtgtcccgcgatgccgtcgacgtggccgcccactggcgcagcgcaggt
gactaccgtggctga

DBGET integrated database retrieval system