KEGG   Corynebacterium efficiens: CE2721Help
Entry
CE2721            CDS       T00103                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cef  Corynebacterium efficiens
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cef00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2903392..2904960)
Genome map
AA seq 522 aa AA seqDB search
MGIPHLGPHAKMGAMRASKANAYVAAIDQGTTSTRCIIIDDTGAVVSVAAKEHEQILPQQ
GWVEHDPVEIWDNVRAVVSQAMVAIDITPYEISSVGVTNQRETTVIWDPATGEPVYNAIV
WQDTRTNEICRELAGEEGQQKWLDRTGLLINSYPAGPKIKWILDNVEGVRERAEKGELYF
GTMDTWLLWNLTGGIRGDDGEEALHVTDVTNASRTLLMDIHTQQWDPELCEALDIPMSLL
PEIKPSIGDYRSVRHRGILADVPITGVLGDQQAALFGQGGFKEGDTKNTYGTGLFLVMNT
GPELKISEHGLLSTIAYQIEGQDPVYALEGSVSMGGSLVQWLRDSLQMIPTAPAIEEFAR
QVPDNGGVHIVPAFSGLFAPRWHPEARGVITGLTRFANRNHICRAVLEATAFQTREVVDA
MARDAGKELESLRVDGAMVQNELLMQMQADILGIDVIRPGDIETTALGTAFAAGLGSGFF
KDFDQIIELISIRQTWTPEMTEAERERAYDAWNEAVTHAYPR
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
ttgggtatacctcacttgggtccgcatgccaaaatgggggccatgagagcatcgaaagcc
aatgcatatgtggcagctatcgaccagggcaccacatccacccgctgcatcatcattgat
gacacgggcgctgtggtctcggtagccgcgaaggaacacgaacagatcctcccccagcag
ggatgggtggaacatgatcccgtggaaatctgggacaatgtccgagccgtggtcagccag
gccatggtcgccatcgacatcaccccgtacgagatctcctccgtcggtgtgaccaaccag
cgcgaaaccacggtgatctgggaccccgccaccggggaacccgtctacaacgccatcgtc
tggcaggacacccgcaccaatgagatctgccgggaactggccggtgaggagggacagcag
aagtggctggaccgcaccggcctgctcatcaactcctacccggccggaccgaagatcaag
tggatcctggacaatgtcgagggggtgcgtgaacgcgccgagaagggggaactctacttc
ggcaccatggacacctggctgctgtggaacctcaccggtggtatccgcggtgatgacggc
gaggaagctctccacgtcaccgacgtgaccaacgcatcgcgtaccctcctgatggacatc
cacacccagcagtgggacccggagctgtgcgaggcactggatatccccatgtccctgctc
ccggagatcaaaccctccataggcgattaccgctccgtgcgtcaccgtggcatccttgcc
gatgtgcccatcaccggagtcctcggtgaccagcaggccgcactcttcggccagggtggt
ttcaaagagggtgacaccaagaacacctacggcaccggtctcttcctggtgatgaacacc
ggccccgaactgaagatctccgagcacggcctgctgtccaccatcgcctaccagatcgag
ggacaggacccggtctacgctctcgaggggtctgtctccatgggtggctccctggtgcag
tggctgcgtgactccctccagatgatccccaccgcccccgccatcgaggagttcgcccgc
caggttcccgacaacggtggagtccacatcgtcccggcgttctccggtctgttcgcacca
cgctggcaccctgaggcacgcggtgtgatcacgggcctgaccaggttcgccaaccgcaac
cacatctgtcgtgccgtcctggaggccaccgccttccagacccgcgaggtcgtggacgcc
atggcccgggatgccggtaaggaactggaatccctgcgcgtcgacggtgccatggtccag
aatgaactgctcatgcagatgcaggccgatatcctcggcatcgatgtcatccgccccggt
gatatcgagaccaccgccctcggtacggccttcgccgcgggtctggggtccggcttcttc
aaggacttcgaccagatcatcgagctgatctccatccgccagacctggacgccggagatg
accgaggcggagcgcgaacgcgcctacgatgcctggaatgaggccgtcacgcacgcctac
ccgcgttag

DBGET integrated database retrieval system