KEGG   Corynebacterium efficiens: CE2872Help
Entry
CE2872            CDS       T00103                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cef  Corynebacterium efficiens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CE2872 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CE2872 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CE2872 (trpB)
Enzymes [BR:cef01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CE2872 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
3057622..3058878
Genome map
AA seq 418 aa AA seqDB search
MTDNKNLGGSTLLPAYFGEFGGQFVAESLLPALDQLEKAFVDATNHPEFRQELAAYLRDY
LGRPTPLTECSNLPLPGQGRGYARIFLKREDLVHGGAHKTNQVIGQALLAKRMGKTRIIA
ETGAGQHGTATALACSLLGLECVVYMGAKDVARQQPNVYRMQLHGAKVIPVESGSGTLKD
AVNEALRDWTATFHESHYLLGTAAGPHPFPTIVREFHKVISEEAKAQMLERTGKMPDVVV
ACVGGGSNAIGMFADFIDEEGVELVGAEPAGEGLDSGKHGATITNGQIGILHGTRSFLMR
SSDGQVEESYSISAGLDYPGVGPQHAHLHSTGRATYVGITDAEALIAFQYLARYEGIIAA
LESSHALAYALKRAKLAEEEGKQITILVSLSGRGDKDVDHIRRTLEEKPELILKEEER
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaacaagaacctcggcggcagcacgctgttgcccgcctacttcggtgagttc
ggtggacagttcgtcgccgagtcactcctgcccgcgctggatcagttggagaaggccttc
gtcgatgccaccaaccatcctgagttccgtcaggagctcgccgcctacctccgcgactac
ctcggtcgcccgaccccgctgaccgaatgctccaacctgccgctgccggggcaggggagg
ggttatgcgcgcatcttcttgaagcgcgaggatctcgtgcacggcggtgcccacaagacc
aaccaggtgatcggtcaggcactgctggccaagcgcatgggcaagacgcgcatcatcgcc
gagaccggtgccggccagcacggcaccgccaccgctctcgcgtgctccctcctcggcctg
gagtgcgtggtctacatgggtgccaaggacgtcgcccgccagcagcccaacgtctaccgc
atgcagctgcacggcgcgaaggtgatccccgtggagtccggttccggcaccctcaaggac
gccgtgaatgaggcgctgcgcgactggaccgccaccttccacgagtcccactacctcctg
ggcaccgccgccggaccgcacccgttcccgacgatcgtgcgcgaattccacaaggtgatc
tccgaggaggccaaggcgcagatgctcgagcgcaccggcaagatgccggatgtcgtcgtc
gcctgcgtcggcggtggctccaatgccatcggcatgttcgcggacttcatcgatgaggag
ggcgtggaactggtcggcgccgagcccgccggggagggcctggattccggcaagcacgga
gccacaatcaccaatggacagatcggcatcctgcacggcacccggtccttcctcatgcgc
agttccgacggacaggtggaggagtcctattccatctccgccgggctggactatcccggg
gtgggcccgcagcacgcccacctccactcaaccggtcgcgccacctatgtcggtatcacc
gacgccgaggcgctcatagcgttccagtacctggcacgctatgagggcatcatcgctgcc
ctggagtcctcccacgctctggcctatgcgctcaagcgcgcaaagctcgccgaggaggag
ggcaagcagatcaccatcctggtgtcgctgtccggccgtggcgacaaggacgtcgaccac
atccgtagaaccctggaagaaaagccggaactgatcctcaaggaggaggagcgctag

DBGET integrated database retrieval system