KEGG   Corynebacterium efficiens: CE2873Help
Entry
CE2873            CDS       T00103                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cef  Corynebacterium efficiens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CE2873 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CE2873 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CE2873 (trpA)
Enzymes [BR:cef01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CE2873 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
3058878..3059720
Genome map
AA seq 280 aa AA seqDB search
MSRYTDMFTRLDEAGEGAFVPFIMLNDPSPEDSFQIISTAIEAGADALELGVPFSDPVAD
GPTVAESHLRALDGGSTVDSCLALIARVREAYPEIPIGMLIYGNVPFTRGLDKFYREFAE
AGADSILLPDVPVREGAPFIQAAEGAGIDPIFIAPAQASETTLEGVSAASKGYIYAISRD
GVTGTERESSTTGLTDVVDNIKRFGGAPILLGFGISSPKHVADAIAAGAAGAITGSAITK
IIASHCEGEHPNPSTITDPEGLRKELTEFISAMKAATKKQ
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgttacaccgacatgttcacccgtctcgatgaggcgggggagggggccttcgtc
cccttcatcatgctcaatgaccccagtccggaagattccttccagatcatctccaccgca
atcgaggccggtgcggatgccctggagctcggcgtgccgttctccgatccggttgcggac
ggccccaccgtggccgagtcacacctgcgcgcactcgatggtggctccaccgtggattcc
tgcctggcgctgatcgcccgtgtgcgtgaggcctacccggagatccccatcggcatgctc
atctacggcaacgtgcccttcacccgcggactggacaagttctaccgcgagttcgccgag
gccggtgcggattccatcctgctgcccgacgtccccgtccgcgagggcgcacccttcatc
caggccgccgagggcgcgggcatcgaccccatcttcatcgccccggcgcaggcctcggag
accaccctggagggtgtcagcgcagcctccaagggttacatctacgccatctcccgtgac
ggtgtcaccggcaccgagcgcgaatcctccaccaccggcctgacggacgtggtggacaac
atcaagcgtttcggtggcgcaccgatcctcctgggcttcggtatttcctccccgaagcac
gtggcggatgcgatcgcagcgggtgccgcgggagccatcaccggctccgcgatcaccaag
atcatcgcctcccactgcgagggtgaacacccgaacccctccaccatcacggaccccgag
ggcctgcggaaggaactgaccgagttcatctctgccatgaaggcagcgacgaagaagcag
taa

DBGET integrated database retrieval system