KEGG   Corynebacterium efficiens: CE2873Help
Entry
CE2873            CDS       T00103                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cef  Corynebacterium efficiens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cef01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cef00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cef00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3058878..3059720
Genome map
AA seq 280 aa AA seqDB search
MSRYTDMFTRLDEAGEGAFVPFIMLNDPSPEDSFQIISTAIEAGADALELGVPFSDPVAD
GPTVAESHLRALDGGSTVDSCLALIARVREAYPEIPIGMLIYGNVPFTRGLDKFYREFAE
AGADSILLPDVPVREGAPFIQAAEGAGIDPIFIAPAQASETTLEGVSAASKGYIYAISRD
GVTGTERESSTTGLTDVVDNIKRFGGAPILLGFGISSPKHVADAIAAGAAGAITGSAITK
IIASHCEGEHPNPSTITDPEGLRKELTEFISAMKAATKKQ
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgttacaccgacatgttcacccgtctcgatgaggcgggggagggggccttcgtc
cccttcatcatgctcaatgaccccagtccggaagattccttccagatcatctccaccgca
atcgaggccggtgcggatgccctggagctcggcgtgccgttctccgatccggttgcggac
ggccccaccgtggccgagtcacacctgcgcgcactcgatggtggctccaccgtggattcc
tgcctggcgctgatcgcccgtgtgcgtgaggcctacccggagatccccatcggcatgctc
atctacggcaacgtgcccttcacccgcggactggacaagttctaccgcgagttcgccgag
gccggtgcggattccatcctgctgcccgacgtccccgtccgcgagggcgcacccttcatc
caggccgccgagggcgcgggcatcgaccccatcttcatcgccccggcgcaggcctcggag
accaccctggagggtgtcagcgcagcctccaagggttacatctacgccatctcccgtgac
ggtgtcaccggcaccgagcgcgaatcctccaccaccggcctgacggacgtggtggacaac
atcaagcgtttcggtggcgcaccgatcctcctgggcttcggtatttcctccccgaagcac
gtggcggatgcgatcgcagcgggtgccgcgggagccatcaccggctccgcgatcaccaag
atcatcgcctcccactgcgagggtgaacacccgaacccctccaccatcacggaccccgag
ggcctgcggaaggaactgaccgagttcatctctgccatgaaggcagcgacgaagaagcag
taa

DBGET integrated database retrieval system