KEGG   Corynebacterium efficiens: CE2880Help
Entry
CE2880            CDS       T00103                                 

Definition
(GenBank) putative tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cef  Corynebacterium efficiens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cef00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CE2880
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CE2880
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CE2880
Enzymes [BR:cef01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CE2880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
3065645..3067147
Genome map
AA seq 500 aa AA seqDB search
MGVAVSAFARPLLVPIACRRLTPPVFPPHPPPGVTVFAEGVPHQLPPMIVSRDCFPESLH
TMTTPATPTRQTLLDAYFGEYGGQFVPEVLLPALDELERAYVEALEDPTFQQELDDLYTN
YLGRPTPITECANLPLEGQGRGTARIFLKREDLVHGGAHKGNQTIGQALLAKRLGKTRLI
AETGAGQHGTATAMVAALFGMKCTVYMGAKDVARQQPNVYRMRLMGAEVVAVDEQSGNGL
SSAIDVAINDWVNNLEDTHYLLGTAAGPHPFPTLVKKFHSVISRESREQMLERTGALPDA
VVACVGGGSNAIGAFAQYLEDQPGNEKVRLIGVEPAGYGLDTDLNGAPIHEGRTMHLHGS
NSYALLDEDGNLRNSHSVSAGLDYPGVGPEHAHLKDTGRAEYVGATDAEALQAFRMLSRY
EGIIPALESSHALAHALKMAAEATEPINILVNLSGRGDKDVAYVRQLLGDHAALDPATDV
LTEVDVLGVLEELTPQADTA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
gtgggggttgccgtttctgcgtttgcgcgccccttgctcgtccccatagcttgtcgacgc
ctgacaccccccgtttttcctcctcacccaccacctggtgttacggtttttgctgaaggt
gtaccccaccagttgccccccatgattgtttcccgtgactgtttcccagaaagcctccac
accatgacaacgccagcaacccctacccgccagaccctccttgacgcctacttcggtgaa
tatggtggacagttcgtcccggaggttctcctcccggcgctcgatgagttggagcgggcc
tatgtggaggccctggaggatcccacgttccagcaggaactggatgatctctacaccaat
tacctcggccgccccaccccgatcaccgagtgcgccaacctgccgctcgaggggcagggg
aggggtaccgcgcggatcttcctcaagcgggaggatctggtccacggtggtgcgcacaag
ggcaaccagaccatcgggcaggcactgctggccaagcgcctgggtaagacccgtctcatc
gcggagaccggcgccggtcagcatggcaccgccaccgcaatggtggcagctctgttcggg
atgaagtgcaccgtctacatgggtgccaaggatgtcgcccgtcagcagccgaatgtctac
cgcatgcgactgatgggtgcggaggtggtcgcggtggatgagcagtccggcaacggcctg
agctccgcaatcgatgtggccatcaacgactgggtgaacaacctggaggacacccactac
ctgctgggcaccgccgcgggcccgcacccgttccccaccctggtcaagaagttccactcg
gtgatctcccgggagtcccgtgagcagatgctggagcgcaccggtgcgctgcctgatgcc
gtggtcgcctgcgtgggtggtggttccaacgccatcggtgcgttcgcccaatatctggag
gatcagcccggcaatgagaaggtccgcctcatcggtgtggaacctgccggctacggtttg
gatacagacctcaatggcgcgcccatccacgagggtcggaccatgcacctgcacggatca
aactcctacgccctgctcgatgaggacggtaacctccgcaactcccattctgtctccgcc
ggtctggattaccccggtgtgggcccggagcacgcccacctcaaggacaccggtcgcgct
gagtacgtgggcgccaccgacgccgaggccctgcaggctttccgcatgctctcccgttat
gagggcatcatccccgccctggaatccagccatgcgctggcccacgccctcaagatggct
gccgaggccaccgaaccgatcaacatcctggtcaatctctccggtcgtggcgacaaggat
gtcgcctatgtgcgccagctcctcggtgatcacgccgccctggacccggccaccgatgtg
ctcaccgaggttgatgtcctgggtgtgctggaggagctcaccccgcaggcagatacggcc
tag

DBGET integrated database retrieval system